KEGG   Ferrimonas balearica: Fbal_3157Help
Entry
Fbal_3157         CDS       T01318                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
fbl  Ferrimonas balearica
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:fbl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3561274..3563028)
Genome map
AA seq 584 aa AA seqDB search
MVHPTLEALQQQVVEHLRLIYPEEDHETLAHRLIHAVGAEGHCVMARPRSEPWDQQDLIV
ITYGDSLRREGERPLHTLKRFVDHYLAHVATGIHILPFFPYSSDDGFAVIDYAQVNPSLG
EWADIRDIAEETRLMADLVINHCSSRSRWFEQFKADEAPGRDYFITADPDEDYHQVVRPR
TSELLKPVTTAAGERHVWCTFSHDQVDLNFANPQVLVEMVRIIQLYLSQGVSIFRLDAVA
FLWKEAGTSCLNLPQTHEIVRLLRTLVSFYDPRILLITETNIPNRENLAYFGNGNEAHAI
YNFSLPPLLLHTMLTGDCNALKLWQMSMPPAQMGTTYLNFIASHDGIGLRPVEGLLEEKQ
IADIATTMEAFGGRISWRSLGEGGLRPYEINIALYDAMKGTLQGPDQYQQARFLCAHAIM
LSLEGLPAIYLHSLLATQNDLDKVANTGNNRSINRHCWDADALEAHLVDVKSHHHQVFVG
LCQLARLRQDQAAFHPSATQFVLHLGDELFGVWRQSQRRDQSIFAVANVTDQVQTLRLSS
LNLIGTQNWWDLLSGDDYPDLHGDIELAPYQSVWLTNRSRETAT
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggtgcacccgactctcgaagcgttgcagcagcaggtggtggagcacctgcgcctgatc
taccccgaagaggaccatgagaccctggcgcaccgcctgatccatgcggtgggggcagag
gggcactgtgtcatggcccggccccgcagcgagccgtgggaccagcaggacctgattgtc
atcacctacggtgacagcctgcggcgtgagggcgagcggccgctgcataccctgaagcgg
tttgttgaccactacctcgctcacgtggccaccggcatccatatcctgccgttttttccc
tacagctccgacgatggctttgccgtcatcgattacgcccaggtcaaccccagcctgggg
gagtgggccgacatccgggacattgccgaagagacccggttgatggcggatctggtgatc
aaccactgctccagccgcagccgttggtttgagcagttcaaagccgatgaggctccgggg
cgcgactacttcattaccgccgacccggacgaggactaccatcaggtggtgcggccccgc
accagtgaactgctgaagccggtcaccaccgccgctggcgagcgtcacgtctggtgcacc
ttcagccatgatcaggttgacctcaactttgccaatccgcaggtgctggtggagatggtg
cggatcattcagctctatctgagtcagggggtgtcgatcttccgtctggatgcggtggcg
tttctgtggaaagaggcgggcaccagctgcctgaatctgccgcagacccacgaaattgtc
cgcctgctgcggactctggtgagcttctacgacccccggatcctgctgatcacggaaacc
aacatccccaaccgggagaacctggcctacttcggcaatggcaatgaggcccacgccatc
tacaacttttcgctgccgccgctgctgctgcacaccatgctgaccggcgactgcaacgcc
ctgaagttgtggcagatgagcatgccaccggcgcagatgggcaccacctacctcaacttt
atcgcgtctcatgatggcatcggcctgcgcccggtggaggggttgctggaggagaagcag
atcgccgacatcgccaccaccatggaagccttcggtggccgcatctcctggcgcagcctg
ggggagggggggctgcgcccctacgagatcaacatcgccctgtatgacgccatgaagggc
acgctgcaggggccggaccaataccagcaggcccgcttcctgtgtgcccacgccatcatg
ttgtcgctggaggggctgcccgccatctacctgcacagtctgttggccacccagaatgat
ctcgacaaggtggccaataccggcaataaccgcagcatcaaccgtcactgctgggatgcg
gacgccctggaggcccatctggtggatgtaaagagccaccaccatcaggtgtttgtgggt
ttgtgccagttggcccggttacgccaggaccaggccgcgttccaccccagcgccacccag
tttgtgctgcacctgggggatgaactgtttggggtctggcggcagagtcagcggcgcgac
cagagcatcttcgcggtggcgaacgtgaccgaccaggtgcagacattgcggctatcaagt
ctgaacctgatcggcacccaaaattggtgggatctgctcagcggtgacgactatccggat
ctgcacggcgacattgaactggccccttaccagagcgtgtggctgaccaaccggtcgcgg
gagacggcgacctag

DBGET integrated database retrieval system