KEGG   Ferrimonas balearica: Fbal_3346Help
Entry
Fbal_3346         CDS       T01318                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
fbl  Ferrimonas balearica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3787840..3788823
Genome map
AA seq 327 aa AA seqDB search
MRRTIVATTLLAVTGLAHAAEPIQVIEPATITNPEMVELGKKLFFEPRLSKSGFLSCNSC
HNLSLGGVDILPTSIGHNWQEGPINAPTVLNAKYMLAQFWDGRAATLQEQAAGPIANPKE
MALEHELALDVLRAIPGYQAEFSEVFGDKGITLDTVTEAIATFEETLVTPNSRFDQYLNG
DKEALSTAEQEGYALFKSKGCAACHNGPAVGGTMYQKMGLMQPFVTSNPAQGRVDVTGKE
HDRMVFKVPTLRNIELTYPYFHDGSTYDLKEAVIVMQRVQLGQELTDQEADRITDFLKTL
TGEQPQITLPILPPSVAGTPKPQPFAK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcaccatcgttgccaccacccttcttgccgttaccggcctggcccatgccgct
gaaccgatccaggtgatcgagccggccaccatcaccaacccggagatggtggaactgggt
aagaagttgttcttcgagccgcgcctgtccaagtccggttttctctcctgtaacagctgc
cacaacctgagcctgggtggcgtggatatcctgccgacctccatcggccacaactggcag
gaaggtcccatcaacgcgccgaccgtactcaacgccaagtacatgctggcccagttctgg
gatggccgtgccgcgaccctgcaggagcaggcagccggccccatcgccaacccgaaagag
atggcgctggaacatgaactggcgctggacgtactgcgcgccatcccgggctaccaggcc
gagttctctgaagtgtttggcgacaagggcatcaccctggacaccgtcaccgaagcgatc
gccacctttgaagagacactggtgacccccaacagccgtttcgaccagtacctcaatggc
gacaaagaggccctgagcaccgctgagcaggagggctacgccctgtttaagagcaagggt
tgtgccgcctgccacaacggtccggccgtgggcggcaccatgtaccagaagatggggctg
atgcagccgttcgtcaccagcaacccggcccagggtcgcgtcgacgtgaccggcaaggag
cacgaccgcatggtgttcaaggtgccgaccctgcgcaacatcgagctgacctacccctac
ttccacgatggctccacctacgacctgaaagaggccgttatcgtgatgcagcgtgtgcag
ctgggccaggagctgaccgaccaggaagcggaccgcattaccgacttcctcaaaaccctg
accggcgagcagccgcagatcaccctgccgattctgccgccgtccgtagccggcacgccg
aagccgcagccgttcgccaagtaa

DBGET integrated database retrieval system