KEGG   Ferrimonas balearica: Fbal_3367Help
Entry
Fbal_3367         CDS       T01318                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
fbl  Ferrimonas balearica
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Fbal_3367
   00670 One carbon pool by folate
    Fbal_3367
Enzymes [BR:fbl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Fbal_3367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3808775..3809266)
Genome map
AA seq 163 aa AA seqDB search
MRIALIACMARNRVIGKDNQMPWHLPADLKHFKAVTLGKPVVMGRRTFESIGRPLPGRHN
IVITRQADYAREGVTVVASIEAAIAAAGAVEELMIIGGGELYAAMLPRADRLYITDVDLD
VEGDTHFPDYQALGWDEVERTVYQPDERNLYTLTFRTLDRRVG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattgcgctgatcgcctgcatggcccgtaaccgggttatcggcaaggacaaccag
atgccctggcacctgccggcggacctgaaacactttaaggccgtaaccctggggaaaccc
gtggtgatgggccgccgcaccttcgagtccattgggcgcccgctgccgggccgccacaac
atcgtgatcacccgccaggcggattacgcccgggaaggcgttaccgtggtggccagcatt
gaggcagccatcgcggccgccggtgccgttgaggagctgatgatcatcggtggcggagag
ttgtatgcggcgatgctgccgcgagcggaccgactctacattaccgacgttgatctggac
gtggagggcgatacgcacttcccggattatcaggcgctggggtgggatgaagttgagcga
accgtttatcagcccgatgaacgaaatctttacaccctcactttccgcaccctggaccga
cgagtcggttaa

DBGET integrated database retrieval system