KEGG   Ferrimonas balearica: Fbal_3410Help
Entry
Fbal_3410         CDS       T01318                                 

Definition
(RefSeq) phosphoketolase (EC:4.1.2.9)
  KO
K01621  
xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
fbl  Ferrimonas balearica
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Fbal_3410
Enzymes [BR:fbl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Fbal_3410
    4.1.2.22  fructose-6-phosphate phosphoketolase
     Fbal_3410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3850413..3852779)
Genome map
AA seq 788 aa AA seqDB search
MASKKELSALKKMVRASNFLSVAQIYLKQNVLLKRPLQHDDIKPRLLGHWGTCPGIAFVY
AHINRLICQHQRPFLYLVGPGHGFPAVQANLFIEGSLSHFYPNTIPYSEAGMRNICEKFS
AAYGYPSHANPEAPGQILEGGELGYSLAVGWGAALDNPDLINVVLVGDGESETGPLAASW
YANRLVNPATCGAVLPILHINGYKISGPTRLGRMDDDEIRMEFTGLGYEVLIVDDQRKED
VYAQMADAMDRAMEAIDEIQTRARSGEDVSKPRWPLIAMRTAKGWTGIKEADGKKLEGNC
DSHQVIINQAASNPQHLSLLNQWLESYQFDDLYKITNEGEVKFDKEIRSLIPPEHLRIGR
QILSYGGEIVRPLNKPDLRQLSYGPETPRGQRGVSMNKMGEWMRDAFRLNSKQRNLRIFS
PDETYSNQLQAVFEETDRAWQWPIEPWDQDMARDGRVMELLSENLLFGMLHGYTVTGRHG
MFPTYEAFAQVVSSMCDQYCKYVYASQGVPFRKPVPACNVVLSSLLERQDHNGYSHQNPS
LLGAMLEKHPTIISAYLPADGNSTLCYTEKAFDDRDKLNVIVAGKKTLPQWLTLEEARRQ
SEEGIMIWDFASDEEPDVVLASCGDYVTQECMAALVIIRQLLPELRIRFVNISELTSDGI
GSLKYGRKPKLLDQFFTSDKGVVINYHGYPNTIHKLLFNYPGIKRCRVKGYVEEGSTTTP
FDMGVRNGTSRYHLVVDMAYKAFQQGVITDAQHIEITTDMLQRLVDHRSYIKAHGVDPQE
ITDWVWSR
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaagaaagagttaagcgctctgaaaaagatggtgcgcgccagcaattttctc
tccgttgcacagatttacctgaagcagaatgtgttgttgaagcgcccgctgcagcacgat
gacatcaagccccggctgctggggcattggggaacctgtcccggcatcgcctttgtctac
gcccatatcaaccgacttatttgtcagcatcagcgccccttcctctatctggtggggccg
ggtcacggcttccccgctgtgcaggccaatctgtttattgagggctctctgtcccacttc
tatcccaataccatcccctattccgaggcggggatgcgcaacatctgtgagaagttctcc
gccgcttacggctacccctcccacgctaacccggaggcccccgggcagatcctggaaggg
ggtgagctgggctactccctggcggtggggtggggggccgcgctggataatccggacctg
atcaacgtggtgctggtcggtgacggggagtcggaaaccggacccctggcggcctcctgg
tatgccaatcgtctggtcaacccggcaacctgtggcgcggtgctgccgattctgcacatc
aacggctacaagatctccgggcccacccgactgggccggatggatgatgacgagatccgg
atggagtttaccgggctgggctacgaagtgctgatcgttgacgatcagcgtaaggaggac
gtctacgcccagatggcggacgccatggaccgggcgatggaagcgatcgatgagatccag
acccgggcccgcagcggcgaggatgtcagcaagccccgctggcctcttatcgccatgcga
accgccaaaggctggaccgggatcaaagaggcggatggcaagaaactggagggcaactgc
gactctcaccaggtgatcatcaaccaggcggccagcaacccgcagcacctgtccctgctg
aaccagtggttggagagttaccagtttgatgacctctacaagatcaccaatgaaggggag
gtgaagtttgataaagagatccgctctttaatccctcccgagcatctgcggattggtcgc
cagatcctctcctatggcggcgagattgtccggccactgaataagccggacctgcgtcag
ctcagttatggtccggagacgccacgaggtcagcgtggggtctccatgaacaagatgggc
gagtggatgcgggacgcgttccggttgaactcaaagcagcgcaatctgcggattttcagc
ccggacgaaacctactcaaaccaactgcaggcggtctttgaggagacggatcgggcctgg
cagtggccgatagaaccctgggatcaggacatggcccgggatggccgggtgatggagctg
ctctccgaaaacctgctgtttggcatgcttcatggctacacggtgacgggacgccacggc
atgttccccacctacgaagccttcgcccaggtggtctcctccatgtgcgaccaatactgc
aaatacgtctacgccagccagggggtgccgttccgtaagccggttccagcctgcaatgtg
gtgctctcctcactgctggagcggcaggaccacaacgggtactcccaccagaacccctct
ctgctgggggcgatgctggagaagcaccccaccatcatctccgcctatctgccggcagac
ggcaacagcaccctgtgctacacggagaaggcgtttgatgaccgggacaagctcaatgtg
attgtggcgggcaagaaaaccctgccccagtggctgaccctcgaggaggcgcggcgccag
agtgaagagggcatcatgatctgggactttgcctcggatgaagagccggacgtggtgctg
gcctcctgcggtgactacgtgacccaggagtgcatggcggcgctggtgatcatccgccaa
ctgttgccggagctgaggatccgtttcgtcaacatctcagagttgacctccgacggcatc
ggcagcctcaagtatggccgtaagcccaagctgctcgaccagttcttcacgtcagacaaa
ggggtggtgatcaactaccacggctatcccaacaccatccataagctgctgttcaactac
ccgggcatcaagcgttgccgggtcaaagggtatgtcgaggagggctccaccaccacgccg
tttgatatgggcgttcgtaacggcaccagccgttaccacctggtggttgatatggcctac
aaggcgttccagcagggggtgatcaccgatgcccagcacattgagatcaccaccgatatg
ctgcagcgcctggtggaccaccgcagttacatcaaggcgcatggggtggaccctcaggag
atcaccgactgggtgtggtcccgctaa

DBGET integrated database retrieval system