KEGG   Ferrimonas balearica: Fbal_3555Help
Entry
Fbal_3555         CDS       T01318                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
fbl  Ferrimonas balearica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Fbal_3555
Enzymes [BR:fbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Fbal_3555
Exosome [BR:fbl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Fbal_3555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4010803..4011813
Genome map
AA seq 336 aa AA seqDB search
MSQVTGAFPRRRPRRIRKHDFSRRLIAENTLTVNDLIYPVFVLEGNNRREAVESMPGVER
LSIDLLLEEMAELVALGVPAVALFPVTPQEKKSLGAEEAFNPEGLAQKAVRALKRAFPEL
GVITDVALDPFTTHGQDGIIDESGYILNDITTEVLVKQALSHAEAGADMVAPSDMMDGRI
GAIRDALEAAGHINTQIMAYSAKYSSSFYGPFRDAVGSAGNLGSGNKHTYQMDPANSDEA
IQEVAMDIEEGADMVMVKPGMPYLDIVRRVKTELKVPTFAYQVSGEYAMLKAAAQNGWLD
EKKVVLEALLCFKRAGADGILTYFAKPVARWLKEAE
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgagccaagtaaccggagcctttccccgtcgacgtccgcgtcgtatccgcaagcacgac
ttttcccgtcgcctgatcgcggagaacaccctgacggtcaacgatctcatctacccggtg
ttcgtactggaaggcaacaaccgtcgcgaagcggttgagtccatgccgggcgtagagcgc
ctgtccatcgacctgctgctggaagagatggcagagctggtggccctgggcgtgcctgcg
gtggccctgttcccggtcaccccgcaagagaaaaaatccctcggtgcggaagaagccttt
aacccggaaggtctggctcagaaagcggttcgtgccctgaagcgcgccttcccggagctg
ggtgtgatcaccgacgtggcgctggatcccttcaccacccacggtcaggacggcatcatc
gacgagtccggctacatcctcaatgacatcaccaccgaagtgctggtgaagcaggctctg
tcccacgccgaagccggtgccgacatggtggccccgtccgacatgatggatggccgtatc
ggcgccatccgtgacgcactggaagccgcgggtcacatcaacacccagatcatggcgtac
tccgccaagtactcctccagcttctacggcccgttccgcgacgccgttggcagcgcaggc
aacctgggcagtggcaacaagcacacctaccagatggacccggccaacagcgatgaagcg
attcaggaagtggccatggacatcgaggaaggggcggacatggtgatggtgaaaccgggt
atgccctacctggacatcgttcgccgcgtgaagaccgaactgaaagtgcccacctttgcc
taccaggtgagtggtgagtacgccatgctcaaagccgcagcccagaatggctggctggat
gagaagaaggtggttctggaagcgctgctgtgcttcaagcgtgccggtgccgatggcatc
ctcacctacttcgccaagccggttgcacgctggctgaaagaggccgagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system