KEGG   Ferrimonas balearica: Fbal_3682Help
Entry
Fbal_3682         CDS       T01318                                 

Definition
3-isopropylmalate dehydrogenase (EC:1.1.1.85)
Orthology
K00052  
3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
fbl  Ferrimonas balearica
Pathway
Valine, leucine and isoleucine biosynthesis
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Fbal_3682
   01230 Biosynthesis of amino acids
    Fbal_3682
  Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    Fbal_3682
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Fbal_3682
Enzymes [BR:fbl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     Fbal_3682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4149625..4150722)
Genome map
AA seq 365 aa AA seqDB search
MREHNIAILAGDGIGPEVMAEAEKVLAAAGQQFGFSFRAEHQLVGGAAIDAHGTPLPAQT
LASCEAADAILFGSVGGPKWEHLPPNEQPERGSLLPLRKHFNLFCNLRPAKIHPGLEPLS
YLRADIAAKGMDVLVVRELTGDIYFGQPRGREGEGEQEYGYDTMRYSRFEIRRIARMAFD
AARQRRGRVLSVDKANVLTTSMLWREEVIAIAADYPDVTLEHIYIDNATMQLLRRASEFD
VILCGNLFGDIISDEAAMITGSMGLLPSASLNESGFGMYEPAGGSAPDIAGQGIANPVAQ
ILSASLMLRHSLGEGAAADAIDSAVSAALADGCLTGELLAPGSQQRPLSTREMGDAIVQR
IKEAR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagggagcacaatatcgccatcctggccggtgacggcatcgggcctgaagtgatggcg
gaagcggaaaaggtgctggccgccgcgggtcagcagtttggcttttcctttcgggccgag
catcagttggttggaggcgccgccatcgacgcccacggtacgccgctgccggcccagact
ctggccagctgtgaagcggcggacgccattttgtttggttcggtgggcggacccaagtgg
gagcacctgcctccgaacgagcagccggaacgcggctcgctgctgcccctgcgcaagcac
ttcaacctgttttgtaacctgcgtccggccaagatccacccgggtctggagccgctctcc
tacctgcgtgccgatatcgccgccaagggcatggatgtgctggtggtgcgcgagctgacc
ggcgacatctactttggccagccccgcggccgcgaaggggagggtgagcaggagtatggc
tatgacaccatgcgctacagccgctttgagatccgccgcatcgcccgcatggcgtttgat
gctgcccgtcagcgtcgtggccgggtgttgtcggtggacaaagccaatgtcctgaccacc
tcaatgctgtggcgggaagaggtgattgccattgccgccgattaccccgatgtgactctg
gaacacatctacatcgacaacgccaccatgcagctgctgcgccgggccagtgaatttgat
gtgatcctctgtggcaacctgtttggcgacatcatctccgacgaagcggcgatgattacc
ggctccatgggcctgctgccctcggccagcctcaatgagtccggctttggtatgtacgaa
ccggccggcggcagtgccccggacattgctggccagggcatcgccaatccggtggcacag
atcctctctgccagcctgatgctgcgccacagcctcggggaaggcgctgccgcggatgcc
atcgacagtgccgtcagtgccgcgttggccgatggctgcctgaccggtgaactgctggcg
ccgggctcacagcaacgccccctctccacccgtgagatgggtgacgccattgttcaacgc
atcaaggaggcccgctga

DBGET integrated database retrieval system