KEGG   Ferrimonas balearica: Fbal_3690Help
Entry
Fbal_3690         CDS       T01318                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fbl  Ferrimonas balearica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Fbal_3690
Enzymes [BR:fbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Fbal_3690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4160147..4160911)
Genome map
AA seq 254 aa AA seqDB search
MHLLLTRPDGRIGPLADKLAALGVRTTRAPMVTLVDNPDAGPSPLDTVDGAFFVSPTAVD
CAHQRLQGKWPDIAYFAVGGGTAAALRRYGVEPICPPPGEETTEGVLALPDWQYLTGKRM
AIVRGVGGREVMAATLRADGFDVQFWELYRRQRPEWPAQTVQSWRQNGVDVILATSGEIL
ANLFAVTPLSDHDWLRNCLWLVPVERVAELAQQRGCQRIQVMGGAGDDAIVRCLGSMNHY
GEDPEGSAGSPGPS
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcacctgttgctgacccgtcccgacgggcgcatcggaccgctggcggacaagctggcg
gccttgggagtgcgcaccacgcgcgctcccatggtgaccctggtggataaccccgacgca
ggccccagcccgctggatacggtggacggggctttttttgtgtccccgactgcggtggat
tgcgctcatcaacgcttgcagggcaagtggccggacatcgcctacttcgcggtagggggc
ggcaccgccgcagccttgcggcgctatggtgttgaaccgatctgcccaccgcccggtgaa
gagaccaccgaaggggtactggcgttgccggactggcaatacctgaccggcaagcgtatg
gcgattgtacgaggggttggcgggcgtgaagtgatggccgccaccctgcgggcggacggt
tttgacgtacaattctgggaactttaccgtcgccaacgtcctgaatggccagcacaaacg
gtgcaaagctggcgccaaaacggggtagacgtcatactggctaccagcggcgaaatcctt
gcaaacctctttgcagtaacgcctttatctgaccacgactggctgcgcaattgcttgtgg
ctggtgcctgtggagcgagttgctgaactggcgcaacagcgcggttgtcagcgcattcag
gtaatgggcggagcgggggatgacgccattgtccgctgcctaggaagtatgaatcactat
ggagaagaccccgaaggatccgcaggatccccaggcccgtcctga

DBGET integrated database retrieval system