KEGG   Ferrimonas balearica: Fbal_3750Help
Entry
Fbal_3750         CDS       T01318                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
fbl  Ferrimonas balearica
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Fbal_3750
Enzymes [BR:fbl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Fbal_3750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4219218..4220168
Genome map
AA seq 316 aa AA seqDB search
MSVDSLWQQVEQGQFAGVDGVAVHYAILRHPNERGAVALCTGRVETYLKYAELVAELYGA
GFTLYLWDHRGQGLSGRMLDNPHIGHVRRFDDYIEDFHRFYQQHIAPAGHRYRALLGHSM
GGAIATAYLQRYPEHFQAAALSAPMYGIRLPVAKAILQPLVSLLASLTPGRYVPGGHDYE
PVRFEENELTGDAGRYQSFRALYEAQPQLQLGDPSLNWLKEALQQVDHLAVAEVTVPILV
MQAGQDSIVDNAAQCAFCARQPQHQLIRYDGARHEILIEQDPIRSAAITASMQWWERHGA
AAPSTVSTANQAAVAR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtggattcactgtggcagcaggtcgaacagggccagtttgccggtgtcgatggg
gtggcggtgcactacgccatattgcgccaccccaacgagcggggggccgtggctctctgt
accggccgggtggaaacctacctgaagtacgctgagctggtggctgaactctacggggcg
ggctttaccctctacctgtgggaccaccgtgggcagggcctgtccggccggatgctggat
aatccccacatcggccacgtgcgccgctttgacgactacatcgaagatttccaccgcttc
taccaacaacatatcgccccggcaggacaccgctaccgcgccctgctgggtcactccatg
ggtggggccattgccaccgcttacctgcagcgctaccccgagcacttccaggctgcggcc
ctgtctgcgcccatgtacggcatccggctgccggtggccaaggcgatactgcaacctctg
gtgtcgctgttggccagcctgaccccgggacgctacgtccccggcggtcacgattacgag
ccggtgcggtttgaggaaaacgagttaaccggtgatgccgggcgataccaaagctttcgg
gccctgtatgaggcgcagcctcagctgcagttgggtgatcccagcctgaactggctgaaa
gaggcgctgcaacaggtcgaccacctggcggtggccgaggtgacggtgccgatcctggtg
atgcaggcgggacaggacagcattgtcgacaatgctgcgcaatgcgccttttgcgcgcgc
cagccccaacaccagctgatccgctacgacggtgcccgccatgagatcctgatcgagcag
gaccccatccgcagcgccgccattacggcgtcgatgcagtggtgggaacggcatggagct
gctgcaccttcaacagtttcaacagcgaatcaagcggccgtggcgcgctga

DBGET integrated database retrieval system