KEGG   Ferrimonas balearica: Fbal_3750Help
Entry
Fbal_3750         CDS       T01318                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
fbl  Ferrimonas balearica
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:fbl00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4219218..4220168
Genome map
AA seq 316 aa AA seqDB search
MSVDSLWQQVEQGQFAGVDGVAVHYAILRHPNERGAVALCTGRVETYLKYAELVAELYGA
GFTLYLWDHRGQGLSGRMLDNPHIGHVRRFDDYIEDFHRFYQQHIAPAGHRYRALLGHSM
GGAIATAYLQRYPEHFQAAALSAPMYGIRLPVAKAILQPLVSLLASLTPGRYVPGGHDYE
PVRFEENELTGDAGRYQSFRALYEAQPQLQLGDPSLNWLKEALQQVDHLAVAEVTVPILV
MQAGQDSIVDNAAQCAFCARQPQHQLIRYDGARHEILIEQDPIRSAAITASMQWWERHGA
AAPSTVSTANQAAVAR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtggattcactgtggcagcaggtcgaacagggccagtttgccggtgtcgatggg
gtggcggtgcactacgccatattgcgccaccccaacgagcggggggccgtggctctctgt
accggccgggtggaaacctacctgaagtacgctgagctggtggctgaactctacggggcg
ggctttaccctctacctgtgggaccaccgtgggcagggcctgtccggccggatgctggat
aatccccacatcggccacgtgcgccgctttgacgactacatcgaagatttccaccgcttc
taccaacaacatatcgccccggcaggacaccgctaccgcgccctgctgggtcactccatg
ggtggggccattgccaccgcttacctgcagcgctaccccgagcacttccaggctgcggcc
ctgtctgcgcccatgtacggcatccggctgccggtggccaaggcgatactgcaacctctg
gtgtcgctgttggccagcctgaccccgggacgctacgtccccggcggtcacgattacgag
ccggtgcggtttgaggaaaacgagttaaccggtgatgccgggcgataccaaagctttcgg
gccctgtatgaggcgcagcctcagctgcagttgggtgatcccagcctgaactggctgaaa
gaggcgctgcaacaggtcgaccacctggcggtggccgaggtgacggtgccgatcctggtg
atgcaggcgggacaggacagcattgtcgacaatgctgcgcaatgcgccttttgcgcgcgc
cagccccaacaccagctgatccgctacgacggtgcccgccatgagatcctgatcgagcag
gaccccatccgcagcgccgccattacggcgtcgatgcagtggtgggaacggcatggagct
gctgcaccttcaacagtttcaacagcgaatcaagcggccgtggcgcgctga

DBGET integrated database retrieval system