KEGG   Flavobacterium branchiophilum: FBFL15_0075Help
Entry
FBFL15_0075       CDS       T01625                                 

Gene name
hemD
Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fbr  Flavobacterium branchiophilum
Pathway
fbr00860  Porphyrin and chlorophyll metabolism
fbr01100  Metabolic pathways
fbr01110  Biosynthesis of secondary metabolites
fbr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FBFL15_0075 (hemD)
Enzymes [BR:fbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     FBFL15_0075 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Phage_head_fibr
Motif
Other DBs
NCBI-ProteinID: CCB68232
UniProt: G2Z3B9
Position
83436..84113
Genome map
AA seq 225 aa AA seqDB search
MIENIKILSTKILSPIQKQVLTDAGLEVLEYNFIQVETKNFELKGIKDHLIFTSQNAVKS
FLNHPQFEKNKTELQAKKAFCVGVKSKSILNESGFEVVAYADYASDLAEIISLIYADGSY
TFFSGNLRKETLPLVLKNAGIEFNEIEVYETLLKPHKIKEVVDAILFFSPSGVESYLKDN
KIKKELCFCIGETTAEAIEKVTKNIIVAQHPSIEALLDDVIEELK
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaaacattaaaatactttctaccaaaatactttcaccaattcaaaaacaagtc
ttgacagatgctggtttggaagtgttggaatataattttattcaggtagaaactaaaaat
tttgaattaaaaggtattaaagaccatttaattttcacgagtcaaaatgcggtaaaaagt
tttttgaatcacccacaatttgaaaaaaataaaacagaacttcaggcgaaaaaagcgttt
tgcgtaggcgtaaaaagtaaatcaattttaaacgaatcaggttttgaagtggttgcttat
gcggattatgcttctgatttggcagaaattattagtttgatttatgccgatgggagctat
acttttttcagtggaaatttgcgaaaagagacgttgcctttggtactaaaaaatgccgga
attgagttcaacgaaattgaggtatatgaaacgctattgaaaccacataagattaaggag
gttgttgatgcgattctatttttcagtccgtcaggcgtagaaagttatttgaaagacaac
aaaatcaaaaaagaattgtgcttttgcattggcgaaaccactgccgaagccatagaaaaa
gtaaccaaaaacattatcgttgcacaacacccttctattgaagccttactcgacgatgta
atcgaagaattaaaataa

DBGET integrated database retrieval system