KEGG   Flavobacterium branchiophilum: FBFL15_0132Help
Entry
FBFL15_0132       CDS       T01625                                 

Gene name
hemB
Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
fbr  Flavobacterium branchiophilum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:fbr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(156071..157063)
Genome map
AA seq 330 aa AA seqDB search
MFPLQRNRRLRQNEVIRSLVRETILLPTDFIVPLFVVEGQQIREEIPSMSQYFRLSLDYL
EQEVKLLWSLGLQSVLLFVKVPDHLKDNAGKEALNANGLMQRAIKTVKNVCPDMLVFTDV
ALDPYSIYGHDGIVENGQIANDATAHFLAQMSISHAQAGADIVAPSDMMDGRIGTIRQAL
EHEGYSHTGIMSYSAKYASAHYGPFRDALDSAPVDLQHIPKDKKTYQMDYHNRIEALRET
QMDIAEGADIVMVKPGIAYLDIVRDIKNAVNVPVAVYQVSGEYAMIKAAAEKGWLDHDAV
MFEQTTAFKRAGADIIASYFAKDIAMILNQ
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgttcccattgcaaagaaaccgccgattgcgacaaaatgaagtaattagaagcctggtt
agagaaactattttgttgcccactgattttatagtgccgctgtttgtagttgaaggacaa
cagattagagaagaaataccgtcgatgagtcagtattttagactgagtttggattacctg
gaacaagaagtcaaactgttatggagtttgggtttacaatcagtattgttatttgtaaaa
gtgcccgaccatttgaaagacaatgctggaaaagaggctttgaacgccaatggtttgatg
caaagagccataaaaacagtaaaaaatgtttgtcctgatatgttggtttttacagatgta
gccctagacccgtattcgatatatgggcatgatggtattgtagaaaatggacaaattgcc
aatgatgccacagcccattttttagcccaaatgagtatttcacacgcccaagcgggtgcc
gacattgtagctcctagcgacatgatggacggcagaattggcactataagacaggcattg
gaacacgaagggtatagccatacgggcattatgagttatagtgcaaaatatgcttcggca
cattatgggccatttagagatgctttagatagtgctccagttgatttgcaacacattcca
aaagacaaaaaaacatatcaaatggactatcataataggatagaagccctacgagaaacc
caaatggatatagccgaaggggctgatattgtaatggtaaaacctggaatagcttatttg
gacattgtaagagatataaaaaatgccgtaaatgttcccgttgcagtatatcaagtatct
ggagagtatgccatgataaaagccgctgccgaaaaagggtggctggatcatgatgccgtt
atgtttgaacaaactacggctttcaaaagggctggagccgatataattgcaagttatttt
gccaaagacatagccatgattttaaatcaataa

DBGET integrated database retrieval system