KEGG   Flavobacterium branchiophilum: FBFL15_0304Help
Entry
FBFL15_0304       CDS       T01625                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fbr  Flavobacterium branchiophilum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FBFL15_0304 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FBFL15_0304 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    FBFL15_0304 (sucB)
Enzymes [BR:fbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FBFL15_0304 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
345313..346536
Genome map
AA seq 407 aa AA seqDB search
MILEMKVPSPGESIKEVEIATWLVKDGDYVEKDQAIAEVDSDKATLELPAEASGIITLKA
EEGDAVAVGAVVCLIDTSAAKPSGNAPAPVAEAVKPAAEAPKVEAPKPVAPAETYATQAP
SPAARKILDEKNIAPASITGTGKGGRITKDDAVNAVPSMGTPTGGNRGSNKTKLSMLRRK
VAERLVAAKNETAMLTTFNEVNMTPINIIRNQYKDAFKAKHGGLGLGYMSFFTKAVTRAL
QLYPDVNSMIDGNDKISYDFCDISIAVSGPKGLMVPVVRNAENLTFRGVEAEIKRLAIKS
RDGQITVDDMTGGTFTITNGGVFGSMLSTPIINPPQSGILGMHNIIERPIAVNGKVEIHP
MMYVALSYDHRIIDGRESVGFLVAVKEALENPLELLMGGNAPKALEL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgattttagaaatgaaagtcccttcacctggggaatccatcaaagaagtagaaatcgca
acttggttagtaaaagatggcgattatgtagaaaaagatcaagcgattgccgaagtagat
tctgataaagctactttggaattgcctgccgaagccagcggtattattactttgaaagca
gaagagggagatgctgttgctgtaggagctgttgtttgtttgatagatactagtgctgca
aaaccttctggtaatgctcctgctccagtagccgaagccgtaaaacctgctgccgaagct
ccaaaagtagaagctccaaaaccagttgctccagccgaaacgtatgctactcaagcacca
tcgcctgcggctagaaaaattttggacgaaaaaaatattgctccagcctctataacggga
acaggaaaaggtggaagaattacaaaagacgatgccgttaatgcggttccttctatgggt
actccaacaggtggcaacagagggtctaacaaaaccaaattgtctatgcttcgcagaaaa
gtagcagaaagattggtagccgccaaaaatgaaacggctatgcttactactttcaacgaa
gtaaacatgacgccaataaacatcatcagaaatcaatataaagatgctttcaaagccaaa
catggtgggttagggcttggttatatgtctttctttacaaaagcagttacaagagccttg
caattgtatccagatgtaaactctatgattgacggaaacgataaaatatcttatgatttt
tgtgatatttctattgcggtttctggtccaaaaggcttgatggtacctgtagtaagaaat
gccgaaaaccttacttttagaggggtcgaagctgaaatcaaacgtttggccatcaaatct
agagatggtcagataactgtagatgacatgacaggtggtacctttaccatcacaaatggt
ggtgtatttggaagtatgttgagtactccaatcatcaaccctcctcaatcaggtatttta
gggatgcacaacattattgaacgtccaattgctgtaaatggaaaagttgaaatccatccc
atgatgtatgtagccctttcttatgatcacagaattattgatggtcgtgagtctgttggt
ttcttggtggccgtaaaagaagcccttgaaaatccattagaattattgatgggtggtaat
gctccaaaagcattagagttgtaa

DBGET integrated database retrieval system