KEGG   Flavobacterium branchiophilum: FBFL15_0304Help
Entry
FBFL15_0304       CDS       T01625                                 

Gene name
sucB
Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fbr  Flavobacterium branchiophilum
Pathway
fbr00020  Citrate cycle (TCA cycle)
fbr00310  Lysine degradation
fbr01100  Metabolic pathways
fbr01110  Biosynthesis of secondary metabolites
fbr01120  Microbial metabolism in diverse environments
fbr01130  Biosynthesis of antibiotics
fbr01200  Carbon metabolism
Module
fbr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fbr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fbr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FBFL15_0304 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    FBFL15_0304 (sucB)
Enzymes [BR:fbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FBFL15_0304 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: CCB68440
UniProt: G2Z4G5
Position
345313..346536
Genome map
AA seq 407 aa AA seqDB search
MILEMKVPSPGESIKEVEIATWLVKDGDYVEKDQAIAEVDSDKATLELPAEASGIITLKA
EEGDAVAVGAVVCLIDTSAAKPSGNAPAPVAEAVKPAAEAPKVEAPKPVAPAETYATQAP
SPAARKILDEKNIAPASITGTGKGGRITKDDAVNAVPSMGTPTGGNRGSNKTKLSMLRRK
VAERLVAAKNETAMLTTFNEVNMTPINIIRNQYKDAFKAKHGGLGLGYMSFFTKAVTRAL
QLYPDVNSMIDGNDKISYDFCDISIAVSGPKGLMVPVVRNAENLTFRGVEAEIKRLAIKS
RDGQITVDDMTGGTFTITNGGVFGSMLSTPIINPPQSGILGMHNIIERPIAVNGKVEIHP
MMYVALSYDHRIIDGRESVGFLVAVKEALENPLELLMGGNAPKALEL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgattttagaaatgaaagtcccttcacctggggaatccatcaaagaagtagaaatcgca
acttggttagtaaaagatggcgattatgtagaaaaagatcaagcgattgccgaagtagat
tctgataaagctactttggaattgcctgccgaagccagcggtattattactttgaaagca
gaagagggagatgctgttgctgtaggagctgttgtttgtttgatagatactagtgctgca
aaaccttctggtaatgctcctgctccagtagccgaagccgtaaaacctgctgccgaagct
ccaaaagtagaagctccaaaaccagttgctccagccgaaacgtatgctactcaagcacca
tcgcctgcggctagaaaaattttggacgaaaaaaatattgctccagcctctataacggga
acaggaaaaggtggaagaattacaaaagacgatgccgttaatgcggttccttctatgggt
actccaacaggtggcaacagagggtctaacaaaaccaaattgtctatgcttcgcagaaaa
gtagcagaaagattggtagccgccaaaaatgaaacggctatgcttactactttcaacgaa
gtaaacatgacgccaataaacatcatcagaaatcaatataaagatgctttcaaagccaaa
catggtgggttagggcttggttatatgtctttctttacaaaagcagttacaagagccttg
caattgtatccagatgtaaactctatgattgacggaaacgataaaatatcttatgatttt
tgtgatatttctattgcggtttctggtccaaaaggcttgatggtacctgtagtaagaaat
gccgaaaaccttacttttagaggggtcgaagctgaaatcaaacgtttggccatcaaatct
agagatggtcagataactgtagatgacatgacaggtggtacctttaccatcacaaatggt
ggtgtatttggaagtatgttgagtactccaatcatcaaccctcctcaatcaggtatttta
gggatgcacaacattattgaacgtccaattgctgtaaatggaaaagttgaaatccatccc
atgatgtatgtagccctttcttatgatcacagaattattgatggtcgtgagtctgttggt
ttcttggtggccgtaaaagaagcccttgaaaatccattagaattattgatgggtggtaat
gctccaaaagcattagagttgtaa

DBGET integrated database retrieval system