KEGG   Flavobacterium branchiophilum: FBFL15_0368Help
Entry
FBFL15_0368       CDS       T01625                                 

Gene name
aceB
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
fbr  Flavobacterium branchiophilum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:fbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FBFL15_0368 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    FBFL15_0368 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    FBFL15_0368 (aceB)
Enzymes [BR:fbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     FBFL15_0368 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(432640..434241)
Genome map
AA seq 533 aa AA seqDB search
MENTEYYTTNMLNFSEETISKYPEILTDEALTFLTLLHENFNDKRLALLEERIKQQFLFD
DGALPDFPTETLDIRISEWIAAPTPADLLDRRVEITGPVDRKMVINALNSGASTFMADFE
DSTSPSWSNLMEGQINLKDAVNKTIRLEDAKRNKTYSLNEKTAVLIVRPRGLHLPEKNLL
YNDKETSGSLMDFGLYLFHNHKQLAQNGTGPYFYIPKLEHYLEARWWNEVFEFAQDYLNI
SRGTIKATVLIETITASFQLDEIIYELKDHIVGLNCGRWDYIFSYIKKLRKNPAFIVPNR
DQVTMTSPFMSAYSQLVIQRCHKRNIHAIGGMAAQIPIKNDEEANNAAFNKVRADKEREA
TNGHDGTWVAHPDLVKVAMEIFNEKMPNANQIEVKRNDVKVTQNDLLEVPLGTVTEEGVR
KNISISILYIASWLSGQGAAALHHLMEDAATAEISRSQLWQWLQNEVVLDNGKPLNEKYY
DWLAIEEFNKIKSMVGEENYEKGNYKLAEQLLDVLVINPNFIDFLTIPGYKYI
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatacagaatattacacaacaaatatgttaaatttttcagaagaaactatttct
aaataccctgaaatattaacagacgaggctttaacttttttgactttactacacgaaaat
tttaatgacaaaagattggctttgttggaagaacgcatcaaacaacaatttctttttgat
gatggtgcacttcctgattttccaacagagactttagacatcagaatctctgaatggata
gcagcaccaacaccagccgacttattggacagacgtgttgaaatcacagggcctgtggac
aggaaaatggttattaatgctctcaactctggtgcttcgacttttatggccgattttgaa
gacagtacatccccgtcgtggagcaacttgatggaaggtcaaattaatttgaaagatgcc
gtaaacaaaaccattagacttgaagatgctaaacgaaacaagacttacagcttgaacgag
aaaactgccgttttgattgttagacctagaggtttgcatttgcccgaaaaaaacttgttg
tataacgacaaagaaacttctggatcgttgatggattttggattatacttatttcacaac
cacaaacaattggctcaaaatggtacgggaccttacttttatatcccaaaattagagcat
tatttggaggcccgttggtggaacgaagtgtttgaatttgctcaagattatttgaatatt
tcaagaggcactataaaagccacggtgttaatagaaaccataacagctagttttcaatta
gacgaaattatttatgaattgaaagaccatattgtgggactcaattgtggacgttgggat
tatattttttcttatatcaaaaaattaagaaaaaaccccgcttttattgttccaaatcgc
gaccaagttaccatgacatcgccttttatgagtgcttattcgcagttggttatacaaaga
tgtcataaacgaaatattcatgctattggtggaatggcagctcaaattccaattaagaat
gatgaagaggcaaacaatgcagcttttaacaaagttagagcagacaaagaacgggaagcc
acaaacgggcacgatggtacctgggtagcacatcctgatttggtaaaagtagctatggaa
atttttaacgaaaaaatgccaaatgccaatcaaattgaggttaaacgcaatgacgtaaag
gtaacgcaaaatgatttgttagaagtgccattgggtactgttacagaagagggggttcgt
aaaaacatcagtatttctatcctatacattgcctcatggttaagcggacaaggtgctgcg
gccttgcaccacctgatggaagatgcagcaactgccgaaatttcaagatcccaattatgg
caatggcttcaaaacgaagtggttttggataacggtaaaccacttaacgagaaatattac
gactggttggccattgaggagtttaataaaataaaatcgatggttggcgaagaaaattac
gaaaaaggcaactataaattagcagaacaattgcttgatgtattggttatcaatcccaat
tttatagactttttgactattccaggctataaatacatttaa

DBGET integrated database retrieval system