KEGG   Flavobacterium branchiophilum: FBFL15_0518Help
Entry
FBFL15_0518       CDS       T01625                                 

Definition
thioredoxin
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
fbr  Flavobacterium branchiophilum
Brite
Enzymes [BR:fbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     FBFL15_0518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(609724..610248)
Genome map
AA seq 174 aa AA seqDB search
MKKQILSLILFLTTIIGQSQELFWETSIDKAIEVSNKTNKPMLMFFTGSDWCGWCIRLQK
EVLKTPEFAIWAKENVVLVELDYPKRTPQADQIKAQNQQLQQVFGIQGYPTICFANASLK
EGKINFEQIGKTGYVAGGPSEWLKGAEEILKNNTKKVQKATKKDQKQAKKNKKK
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacaaattttatccttaatcttatttttaacaacaattatcggacagtctcaa
gaattattttgggaaaccagtatcgataaagccattgaagtgtccaataaaaccaacaaa
cctatgttgatgttttttaccggtagcgactggtgtgggtggtgcatccgattgcaaaaa
gaggttttgaaaacccctgaatttgccatttgggcaaaagaaaatgtagttttggtagaa
ttggattacccaaaacgaacaccacaagcagatcaaataaaagctcaaaaccaacaactg
caacaagtttttggcatacaaggttatcctaccatttgttttgccaatgcctctttgaaa
gaagggaaaattaattttgaacaaattggcaaaacaggttacgtagcaggcggcccttca
gaatggttgaaaggagctgaagagattttgaaaaataacactaaaaaagttcaaaaagcc
accaaaaaagaccaaaaacaagcaaagaaaaataagaaaaaataa

DBGET integrated database retrieval system