KEGG   Flavobacterium branchiophilum: FBFL15_0678Help
Entry
FBFL15_0678       CDS       T01625                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fbr  Flavobacterium branchiophilum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:fbr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
789542..790285
Genome map
AA seq 247 aa AA seqDB search
MKVKTILVSQPEQKIENSPYFDIQQKHKVKIDFRPFIHVEGATAKDVRAQKIDLNHFSAI
ILTSKNAVDHFFRVAEEMRYKIPEDLKYFCQSEAIAFYLQKYVVYRKRKIYVGSKDFSDM
SALIKKHKEEKFLLPASDQLNADVPVTLNNLKVAWSHAVFYKTVMSDLSDLADVYYDVLA
FFSPTGIKSLFKNFPNFEQKETKIAVFGSSTQKEAIEHGLRVDIMAPSPESPSMTMALEK
YLAKANK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgaaaacaattttggtatcgcaacctgaacaaaaaatcgaaaattcaccgtac
tttgacattcaacagaaacacaaagtaaaaattgacttcagaccttttattcatgttgag
ggtgcaaccgcaaaagacgtaagggcacaaaaaatagatttgaaccatttctcagctatc
attctaaccagtaaaaatgctgtggaccatttttttagagttgcagaagagatgcgttat
aaaatacctgaagatttaaaatatttttgtcagtcagaagccatcgctttttatctgcaa
aaatatgtggtttatcgaaaaagaaaaatttatgtcggttcaaaagacttttctgatatg
tctgctttaataaaaaagcataaagaagaaaaatttttattacccgcatcagaccagctc
aatgctgatgtcccagtaactttaaacaatctaaaagtagcatggtctcacgccgttttt
tataaaacagtaatgagcgatttaagcgatttggccgatgtttactatgatgtattggca
ttttttagcccaacaggtatcaaatcgttgtttaagaatttccctaattttgaacaaaaa
gaaaccaaaattgctgtttttggtagttccacacaaaaagaagccatcgagcacggcctt
cgagtagatattatggccccgtcgccagaaagcccttccatgacaatggctctcgaaaaa
tatctcgccaaagccaacaaataa

DBGET integrated database retrieval system