KEGG   Flavobacterium branchiophilum: FBFL15_0708Help
Entry
FBFL15_0708       CDS       T01625                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
fbr  Flavobacterium branchiophilum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:fbr00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:fbr00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
829882..831333
Genome map
AA seq 483 aa AA seqDB search
MKLLNKILENVKIDSLIGVDEVSIEQIVFDSRKIAANDLFVAIRGSLSNGHSFIDKAIQM
GAIAIVCDVFPDQLVSNITYIKVPDTNEAMAIMAANYYEKPSEKLKLVGITGTNGKTTIA
TLLYQLFQKAGYKVGLLSTVKIMVDQQEYKATHTTPDSITINKYLHEMVSRGVTHCFMEV
SSHGIHQKRTEGLCFEGGVFTNLTHDHLDYHQSFAEYRDVKKAFFDHLPQKAFALTNIDD
KNGAVMLQNTKAQKRSYSLKTLADYKAQILENQLAGLLLTINDNEVWVRLIGTFNAYNVL
AIFGTASALGLDKMETLRILSELESVSGRFQYMISANQITAIVDYAHTPDALENVLKTIN
DIRTKNEKLFTIVGCGGDRDTTKRPLMAQIATAMSDTVFITSDNPRTEDPQSIIEAMEKG
VAPQHFNKFMSILDRKQAIKTACNFAKPGDIILIAGKGHETYQEIMGVKYDFDDMKIVSE
FLK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgttaaataaaatattagaaaatgtaaaaatcgacagtttaattggtgttgat
gaggtgtcaattgaacaaatagtatttgattcaagaaaaatagccgcaaacgatttgttt
gtagccataagagggagtttgtcaaacgggcattcgtttattgacaaagccattcaaatg
ggggctattgctattgtatgcgatgtttttcctgatcaattagtttcaaatattacttat
atcaaagtgcctgatactaatgaggccatggccataatggcggctaattattatgaaaaa
ccttcagaaaaattaaaattagttggtattacgggcacaaatggcaaaaccactatcgca
actttattataccaattgtttcaaaaagctggttataaggtaggtttgctttcaacagta
aaaattatggtcgatcagcaggagtacaaagccacacacaccacgccagattctattacg
atcaataagtatttacatgaaatggtttctcggggtgttacccactgttttatggaggta
agttcgcacggtatccatcaaaaacgtacagagggcctgtgctttgaagggggtgttttt
accaatttgacccatgatcatttggattaccatcaatcatttgcagaatatagagatgtt
aagaaagcctttttcgatcatttgccacaaaaagcatttgcattaaccaatatcgatgac
aaaaatggtgctgtaatgttgcaaaacaccaaagcccaaaaacgcagttattctcttaaa
actttggctgattataaagctcaaatacttgaaaatcaattagctggattgttacttact
attaatgataatgaagtatgggtacgcttgataggtacttttaatgcttataatgtgtta
gccatttttggtactgcaagcgctttgggcttagacaaaatggaaacattaagaatcttg
tctgaattagaaagtgtttcgggacgatttcaatatatgatttcggcaaatcaaataacg
gccattgtagattatgctcacacgcccgatgccttggaaaatgtattgaaaaccattaac
gatattcgtacaaaaaacgaaaaattatttacaattgtaggttgtggaggcgacagggat
actaccaaacgcccgttgatggcccaaatagctactgcaatgagcgataccgtttttata
acttctgataatccaagaacagaagaccctcaaagcatcatcgaagccatggaaaaaggg
gtggctccacagcattttaataaattcatgtctattttagacagaaaacaagccatcaaa
actgcttgtaattttgcaaaacctggcgatattatacttattgcgggcaaaggacacgaa
acatatcaagaaattatgggtgttaaatacgattttgacgatatgaaaatagtctcagaa
tttttaaaataa

DBGET integrated database retrieval system