KEGG   Flavobacterium branchiophilum: FBFL15_0734Help
Entry
FBFL15_0734       CDS       T01625                                 

Gene name
recR
Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
fbr  Flavobacterium branchiophilum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fbr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FBFL15_0734 (recR)
DNA repair and recombination proteins [BR:fbr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      FBFL15_0734 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
858670..859290
Genome map
AA seq 206 aa AA seqDB search
MEFSSKLLEKAVVEVSQLPGIGKRSALRLVLHLLKQPKEQTQMLSDALLKMRQDIKLCTN
CFNISDVDVCEICSNPKRNPKLICVVEDVRDVMAIENTGQFKGVYHVLGGKISPIDGIGP
NQLNIKPLIEKVKLGLVTELIFALSATMEGDTTNFYIYKQVQNQQIVLSTIARGIAVGDE
LEFADEVTLGRSILHRIPFENALKNV
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcatcaaaattattagaaaaagcagttgtcgaggtgtctcaattgccagga
attggcaaacgttcggcgttaagattggttttgcacttactcaaacaacccaaagagcaa
actcaaatgttgagcgatgcgttgttgaaaatgcgtcaagatattaaactttgtacgaat
tgttttaacatatccgatgtcgatgtgtgcgaaatttgttccaatcccaaacgaaatccc
aaactcatttgtgtagtagaagatgtaagagacgtaatggctattgaaaatacaggacaa
tttaaaggggtttatcacgtgttgggtggcaaaatttcgcctattgatggaataggccca
aatcaattgaatatcaagccgttaatagaaaaagtgaagttaggattggtaacagaattg
atttttgctttgagtgcgactatggaaggcgataccaccaatttttatatatacaaacaa
gttcaaaaccaacaaattgtgctatcaacaatagctagaggcattgccgttggcgacgaa
ttggagtttgcagacgaagttacgttaggaagaagcatcttgcataggattccttttgaa
aacgctttgaaaaatgtttga

DBGET integrated database retrieval system