KEGG   Flavobacterium branchiophilum: FBFL15_1042Help
Entry
FBFL15_1042       CDS       T01625                                 

Gene name
asnB2
Definition
asparagine synthetase AsnB2 (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
fbr  Flavobacterium branchiophilum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fbr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FBFL15_1042 (asnB2)
Enzymes [BR:fbr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     FBFL15_1042 (asnB2)
Peptidases [BR:fbr01002]
 Cysteine Peptidases
  Family C44
   FBFL15_1042 (asnB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1222731..1224581
Genome map
AA seq 616 aa AA seqDB search
MCGISGIINFNNQKVQELELLSMVQAMKHRGPDDQGIFIDNTVGFGFVRLSIIDLSSAGH
QPFQSEDQRYTMVFNGEIYNYVELREELIRNGTVFNTKTDTEVLLKSYIKWGKDCLHKFN
GMWAFAIYDNQEKTVFFARDRFGVKPFYYYSDENNFYFASEIPSILAVLKAKPKANEQAI
FDYLVFNKTEHNSQTFFEGIEKISHGHCLFVDLKKQKNTIAPEKWYDLRENVKKSTGFSS
PNEFKDVFVEAVKLRLRSDVPVGVCLSGGLDSSSIVSVIIDHLNVANLNTFSAVFDNNFS
GDESKFILEYADKPGQRHYITPTAETLYDDLDDFITCHTEPIPSTSPYAQYKVMQKAQNN
VVVTIDGQGADEHLAGYHYIFGFYFKDLLINLKWYTLLKEMYYYLKIHKSTFGLKTFLFF
LLPKNIRTKTKVNDLGYFNVKFVNDYLKKSSISDNLYGSKSLKDSLLNHFEYKLEHLLKW
GDRNSMHFSIESRVPFLDYKLVEKSLATKSNEIIKNGMTKSILRKSMKGILPEVIRNRVD
KIGFETPQDEWFREIKWQNKINNIITSESFGNRGIFDQKNVVKKYKKHISREINISNEIW
KWVHLELWFRKYIDEL
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatttcgggaataatcaatttcaataaccaaaaggttcaagagttggaactg
ctgtctatggttcaagccatgaaacacagagggccagacgatcaaggtatatttattgat
aatacggttggttttggatttgtaagattaagtatcatcgatttgtctagtgcaggacat
cagccatttcaaagtgaagaccaaagatacaccatggtatttaatggggaaatatataat
tatgtagaattaagagaagaacttatacgaaatggaacggtttttaataccaaaaccgat
acagaagttttgttaaaatcatatatcaaatggggaaaagattgcttgcataagtttaat
ggtatgtgggcttttgctatatatgataatcaagaaaaaacagtgttttttgcaagggat
agatttggagtaaagcctttttattattattcagatgagaataatttttattttgcctca
gaaattccatctatattagcagtattaaaagcaaaaccaaaagcaaacgaacaggcaata
tttgattatttagtttttaataaaacagaacataacagtcaaaccttttttgagggtata
gaaaaaatatcgcacggtcattgtttgtttgttgatttgaaaaaacaaaaaaatacgatt
gcacctgaaaaatggtatgatttaagggaaaatgttaaaaaaagcacaggtttttcttca
cctaatgaatttaaagatgtatttgtagaggctgtaaaactaagattacgaagtgatgtg
ccggttggagtatgtttaagtggtggcttggactcttcttcaattgtgtcggttataatt
gatcatttaaacgtagcaaacttaaatactttttcggcggtttttgataataatttttct
ggcgatgaatcaaaatttatattagaatatgcagataaaccaggacaaagacattatata
acccctactgccgaaactttgtatgacgatcttgatgattttataacttgccatacagag
ccaatcccgtcaacatcaccttatgcacaatacaaagtgatgcaaaaggcacaaaataat
gtagttgttactattgatggtcagggtgcagacgaacatttggcgggttaccattacatt
tttgggttttattttaaagatttattaatcaatttaaaatggtacactttgttgaaagaa
atgtactattacttgaaaatacataaatccacttttgggcttaaaacgtttttgtttttt
ttacttcctaaaaatattcgaaccaaaacaaaagtgaatgatttaggttattttaatgtt
aaatttgttaatgattatttaaaaaaatcaagtatttctgataatttgtatggttccaaa
agtttaaaagattcattattaaatcattttgaatacaaactcgaacatttattaaaatgg
ggtgatagaaattcaatgcatttttcaatagaatcaagagttccatttttggattataag
ctggttgaaaaatcgttggctacaaaatcgaatgaaataataaaaaatggaatgactaaa
agcattttacgtaaatcgatgaaaggtattttacccgaagttataagaaacagagtagat
aaaattggttttgaaacccctcaagatgagtggtttagagaaataaaatggcaaaacaaa
ataaataatataataacaagtgaatcttttggtaacagaggaatttttgatcaaaaaaat
gtggttaaaaaatataaaaagcacattagtagagaaataaatatttcaaatgaaatttgg
aaatgggtacatttagaattatggtttagaaaatatatagatgagttatga

DBGET integrated database retrieval system