KEGG   Flavobacterium branchiophilum: FBFL15_1094Help
Entry
FBFL15_1094       CDS       T01625                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
fbr  Flavobacterium branchiophilum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fbr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1277541..1278395
Genome map
AA seq 284 aa AA seqDB search
MNFQNNTLQTSQSLNCNGTLLDLTIPKVMGILNLTPNSFYDGGHFTNHNQVLHQVEKMLQ
EGATFIDIGAYSSKPNAEFVSEMDEINRLKPFLKHIIKEFPGILVSIDTFRSRVAQFAVE
NGACMVNDIAAGTLDDKMFETMAHLQVPYIMMHTRGTPQNMQNLTHYNHLIKEINEYFSE
KISKAKQHGITDIVIDPGFGFAKTLQQNYHLMQHLSLLNIHDLPILVGISRKSMIYKLLE
TTPTQALNGTTVLHTIALQKQAKILRVHDVKEAIECIKIVQCLT
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaattttcaaaacaacacattacaaacttcacaatccttgaattgtaacggtacctta
cttgatttgactatcccaaaagttatgggcattttaaacctcacgcccaattctttctac
gatggaggacattttacaaaccacaatcaagtgttgcatcaagtggaaaaaatgcttcaa
gaaggggctacttttatagatattggggcttattcgagcaaaccaaacgccgaatttgtt
tctgaaatggatgaaataaaccgactaaagcctttccttaagcatattattaaagaattt
cctggaatattggtttctatagatacttttcgtagtcgtgttgcacaatttgcagtagaa
aatggggcttgtatggttaatgatattgccgcagggacattagatgataaaatgtttgaa
acgatggctcatttgcaagtaccttatattatgatgcacacacggggtacacctcaaaac
atgcaaaatttaacacactataatcatttaattaaagaaataaacgaatatttttctgaa
aaaataagtaaagccaaacaacacggtattactgatattgtcatcgaccctggatttgga
tttgccaaaaccttacaacaaaattaccatttgatgcagcatttatcgcttttaaatatt
catgatttgcctattttagttggaatttccagaaaatcaatgatctataaattgctagaa
actaccccaacccaagccttaaatgggacaactgttttgcatacaatagccttacaaaaa
caggctaaaattttgcgtgtgcacgatgtaaaagaagccatagaatgtataaaaatagta
caatgtttgacttaa

DBGET integrated database retrieval system