KEGG   Flavobacterium branchiophilum: FBFL15_1219Help
Entry
FBFL15_1219       CDS       T01625                                 

Gene name
tpiA
Definition
(RefSeq) Triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fbr  Flavobacterium branchiophilum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FBFL15_1219 (tpiA)
   01230 Biosynthesis of amino acids
    FBFL15_1219 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FBFL15_1219 (tpiA)
   00051 Fructose and mannose metabolism
    FBFL15_1219 (tpiA)
   00562 Inositol phosphate metabolism
    FBFL15_1219 (tpiA)
Enzymes [BR:fbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FBFL15_1219 (tpiA)
Exosome [BR:fbr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FBFL15_1219 (tpiA)
  Exosomal proteins of bladder cancer cells
   FBFL15_1219 (tpiA)
  Exosomal proteins of melanoma cells
   FBFL15_1219 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1425049..1425801)
Genome map
AA seq 250 aa AA seqDB search
MRTKIVAGNWKMNKNAEQTEDLLNELIDQLPSDKEVKIIVAPTFVNLSSAVEHLNFTNIT
VAAQNMHQAEGGAFTGEISADMLKSIGVNTVILGHSERRAYCHETDALLANKVDTALKHE
MDVIFCFGEELKDRQDKQHFNVVENQLRDGLFHIEKSSWEHIILAYEPVWAIGTGETASP
EQAQEMHEFIRATIRKGFGADIAEGVSILYGGSVKPDNAKEIFSKPDVDGGLIGGAALKA
SDFVAIVNGI
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaaaaattgtagcaggaaactggaaaatgaacaaaaatgccgagcaaacggaa
gatttgttgaatgaattgatagaccaattgccatcggacaaagaagtaaaaattatagtg
gctccgacatttgtaaatttgtcatcggcagttgagcatttgaattttacaaacattacg
gttgcggcacaaaacatgcaccaagccgagggcggggcatttacgggagaaatttcggca
gatatgctaaaaagtattggcgtgaacaccgtgatattgggtcattctgaaagaagagcc
tattgtcatgaaaccgatgcgttgttggccaataaagtagatacggcactgaagcatgaa
atggatgtgattttttgttttggagaggagttgaaagaccgtcaagacaagcaacacttt
aatgtggtagaaaatcaattaagagatggcttgtttcatatagaaaaatcatcgtgggaa
catattattttggcttatgagcccgtatgggccattggtacaggagaaacggccagtccg
gaacaggcacaagaaatgcacgagtttatacgagcaacaattagaaaaggatttggagca
gatattgcagagggtgtttcgatattgtatggaggcagtgtaaagccagataatgccaaa
gaaatattttctaaacccgatgttgatggtggtttgattggtggtgctgctttgaaagct
tcggattttgtggctattgtaaatggcatttag

DBGET integrated database retrieval system