KEGG   Flavobacterium branchiophilum: FBFL15_1268Help
Entry
FBFL15_1268       CDS       T01625                                 

Gene name
bfmBB
Definition
dihydrolipoyllysine-residue (2-methylpropanoyl) transferase (EC:2.3.1.168)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fbr  Flavobacterium branchiophilum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FBFL15_1268 (bfmBB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FBFL15_1268 (bfmBB)
  Amino acid metabolism
   00310 Lysine degradation
    FBFL15_1268 (bfmBB)
Enzymes [BR:fbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FBFL15_1268 (bfmBB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1479000..1480322
Genome map
AA seq 440 aa AA seqDB search
MAKFELKLPKMGESVAEATITNWLKQIGDTIEADEAVLEIATDKVDSEVPSEVSGILIEQ
LFQKDDLVQVGQTIAIIEVPGDEVADSDNVKPEIVATLEKNIETVIEQKSAFTNPVVSDK
FYSPLVKNIAKQENVSLAALDLIVGSGKDGRVTKEDILTYVAQRGINNQNIENEAVIHDL
VSKPIQQSIQNDAIQSAVVPPSVNGGDEIVEMDRMRKLISGYMVASVQTSAHVQSFIEVD
VTNIVKWRDKNKASFEKREGEKLTFTPIFMEAVAKALKDFPGMNISVEGTYIIKKKNINL
GMAAALPNGNLIVPVIKNADQLNLVGMAKAVNDLGNRAKMGKLKPDDTQGGTYTVTNVGT
FGSVFGTPIINQPQVGILALGAIRKVPAVIETPEGDFIGIRQKMFLSHSYDHRVVDGALG
GSFVKRVADYLEAFDINRTV
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatttgaattgaaacttccaaaaatgggagaaagtgttgcagaggcaaccatt
acaaattggttaaaacaaattggcgataccattgaagccgatgaagccgtactcgaaatt
gccacagacaaagtggatagcgaagtgccaagcgaagtttcgggtatattaatagaacaa
ttatttcaaaaggacgatttggtacaagtgggacaaaccattgctattattgaagttccg
ggtgatgaagtggcagattccgataatgtaaagccagaaattgttgccacactcgaaaaa
aacattgaaactgtaattgagcaaaaatcagcttttacaaaccccgttgtatcagataaa
ttttattcgccattggtcaaaaatattgccaaacaagaaaatgttagtttagcagcatta
gatcttatagtgggttctggcaaagatggtcgggttacaaaagaagatatcttgacttat
gttgcccaacgaggcattaataatcaaaatattgaaaatgaagctgttatacatgatctt
gtttcaaaaccgatacaacaatcgatacaaaatgatgccattcaatcagctgttgttcct
ccttcagtaaacggaggagacgaaattgttgaaatggatcgcatgcgaaagttaatttca
ggttatatggttgcctctgtgcaaacttctgcacatgttcaatcattcatagaagttgat
gttactaatattgtaaaatggcgagacaaaaacaaagccagttttgaaaaaagagaaggc
gaaaaacttacttttacgccaatttttatggaagctgtagccaaagcattgaaagatttt
cctggtatgaatatatctgtggaaggaacatatattatcaaaaagaaaaacatcaatttg
ggtatggcagcagcattgcctaatggcaatttgattgttcctgttattaaaaatgccgat
caattgaatttagtaggtatggctaaagcggttaacgatttgggtaatcgtgccaaaatg
ggcaaactgaaaccagatgatacccaaggcggcacctatacagttacaaatgttggtacc
tttggcagcgtttttggcactccaattatcaatcaaccacaagtgggcattttagcttta
ggtgccattagaaaagtgcctgcggtaatagaaactccagagggcgattttataggcatt
cgtcaaaaaatgttcctatcacacagctacgaccaccgtgttgtagatggtgctttaggt
ggtagttttgtaaaaagagttgcagattatttagaagcttttgacatcaacagaacggtt
taa

DBGET integrated database retrieval system