KEGG   Flavobacterium branchiophilum: FBFL15_1268Help
Entry
FBFL15_1268       CDS       T01625                                 

Gene name
bfmBB
Definition
dihydrolipoyllysine-residue (2-methylpropanoyl) transferase (EC:2.3.1.168)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fbr  Flavobacterium branchiophilum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FBFL15_1268 (bfmBB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FBFL15_1268 (bfmBB)
  Amino acid metabolism
   00310 Lysine degradation
    FBFL15_1268 (bfmBB)
Enzymes [BR:fbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FBFL15_1268 (bfmBB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1479000..1480322
Genome map
AA seq 440 aa AA seqDB search
MAKFELKLPKMGESVAEATITNWLKQIGDTIEADEAVLEIATDKVDSEVPSEVSGILIEQ
LFQKDDLVQVGQTIAIIEVPGDEVADSDNVKPEIVATLEKNIETVIEQKSAFTNPVVSDK
FYSPLVKNIAKQENVSLAALDLIVGSGKDGRVTKEDILTYVAQRGINNQNIENEAVIHDL
VSKPIQQSIQNDAIQSAVVPPSVNGGDEIVEMDRMRKLISGYMVASVQTSAHVQSFIEVD
VTNIVKWRDKNKASFEKREGEKLTFTPIFMEAVAKALKDFPGMNISVEGTYIIKKKNINL
GMAAALPNGNLIVPVIKNADQLNLVGMAKAVNDLGNRAKMGKLKPDDTQGGTYTVTNVGT
FGSVFGTPIINQPQVGILALGAIRKVPAVIETPEGDFIGIRQKMFLSHSYDHRVVDGALG
GSFVKRVADYLEAFDINRTV
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatttgaattgaaacttccaaaaatgggagaaagtgttgcagaggcaaccatt
acaaattggttaaaacaaattggcgataccattgaagccgatgaagccgtactcgaaatt
gccacagacaaagtggatagcgaagtgccaagcgaagtttcgggtatattaatagaacaa
ttatttcaaaaggacgatttggtacaagtgggacaaaccattgctattattgaagttccg
ggtgatgaagtggcagattccgataatgtaaagccagaaattgttgccacactcgaaaaa
aacattgaaactgtaattgagcaaaaatcagcttttacaaaccccgttgtatcagataaa
ttttattcgccattggtcaaaaatattgccaaacaagaaaatgttagtttagcagcatta
gatcttatagtgggttctggcaaagatggtcgggttacaaaagaagatatcttgacttat
gttgcccaacgaggcattaataatcaaaatattgaaaatgaagctgttatacatgatctt
gtttcaaaaccgatacaacaatcgatacaaaatgatgccattcaatcagctgttgttcct
ccttcagtaaacggaggagacgaaattgttgaaatggatcgcatgcgaaagttaatttca
ggttatatggttgcctctgtgcaaacttctgcacatgttcaatcattcatagaagttgat
gttactaatattgtaaaatggcgagacaaaaacaaagccagttttgaaaaaagagaaggc
gaaaaacttacttttacgccaatttttatggaagctgtagccaaagcattgaaagatttt
cctggtatgaatatatctgtggaaggaacatatattatcaaaaagaaaaacatcaatttg
ggtatggcagcagcattgcctaatggcaatttgattgttcctgttattaaaaatgccgat
caattgaatttagtaggtatggctaaagcggttaacgatttgggtaatcgtgccaaaatg
ggcaaactgaaaccagatgatacccaaggcggcacctatacagttacaaatgttggtacc
tttggcagcgtttttggcactccaattatcaatcaaccacaagtgggcattttagcttta
ggtgccattagaaaagtgcctgcggtaatagaaactccagagggcgattttataggcatt
cgtcaaaaaatgttcctatcacacagctacgaccaccgtgttgtagatggtgctttaggt
ggtagttttgtaaaaagagttgcagattatttagaagcttttgacatcaacagaacggtt
taa

DBGET integrated database retrieval system