KEGG   Flavobacterium branchiophilum: FBFL15_1324Help
Entry
FBFL15_1324       CDS       T01625                                 

Definition
glycoside hydrolase family protein (EC:3.2.1.-)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
fbr  Flavobacterium branchiophilum
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fbr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    FBFL15_1324
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    FBFL15_1324
Enzymes [BR:fbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     FBFL15_1324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1541129..1542589
Genome map
AA seq 486 aa AA seqDB search
MKKITIFVHLLTTFFVFSQNKKNTNPSTFSVNNRTVEVYTSADNSLLRLSKDDKIYHFET
MKQPLETQICIFVNPEKKFQKFLGIGGAITDASAEVFARLNPDKQQELLEAYFSKTKGIG
YTVVRTNMHSCDFSSHSYTYVQEGDKDLKTFSLAPDQKFRLPLLKRALQTIGNSYTFYVS
PWSPPAFMKDNQSMLEGGKLLPEYYQTWANYYVKYINALQNEGLNVWGLTIQNEPMAKQR
WESCIYSAEEERDFLKNYLGPTLKKAGLGQKKIIVWDHNRDLISQRAHVILSDSKASQYA
WGVGFHWYENWSGGNPMFENIKHVNDLYPNKNLMFTEGCVERFDPSKYQLWANGERYGRS
MIHDFNNGTVGWTDWNILLDENGGPNHVQNFCFAPIHADSQSGNLIYTPSYYFLGHFSKF
IDKNAHRVSSVASRSQLLTTSFLNPNGKLTTIIMNETNQNVQYYLCIGASAVALDILPHS
IQTVVF
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataactatttttgtacatttattaacaactttttttgttttttctcaaaat
aaaaaaaacaccaatccctctactttttctgtaaataatagaactgttgaggtatataca
tctgcagacaacagtctattacgattgtcaaaagatgacaaaatttaccattttgaaaca
atgaagcaacctttggaaactcaaatttgtatttttgttaatcctgaaaaaaagtttcaa
aaatttttaggaattggtggcgccataaccgatgccagtgctgaggtttttgctcgtttg
aatccagataaacaacaagaattgctagaggcatatttctctaaaacaaaaggtattggt
tatacagttgtaagaaccaacatgcacagttgcgattttagctctcattcctatacttat
gttcaagaaggagacaaagatttaaaaacttttagcctagcacccgaccaaaaattcagg
ctgcctttgctcaaaagagccttacaaaccattggcaattcctatactttttatgtaagt
ccgtggtcgccaccagcatttatgaaagacaatcaaagcatgttagagggaggtaaatta
ttgccagaatattatcaaacgtgggcaaattattatgtaaaatacatcaatgcccttcaa
aatgagggtttaaatgtatggggtttaactattcagaatgagccaatggccaaacaacga
tgggaatcatgtatatattccgctgaagaggaacgtgattttttgaaaaattatttgggg
ccaacgctaaaaaaagcaggcttaggacaaaagaaaatcattgtttgggatcataatcga
gatttgatttcacaaagagctcatgtaattttaagcgatagtaaagccagccaatatgcg
tggggtgttggttttcattggtacgaaaattggagtgggggcaacccaatgttcgaaaac
attaagcatgtaaacgacttgtatccaaacaaaaatttaatgtttacggaaggttgtgtg
gagcgttttgatccatcaaagtaccaattgtgggcaaatggtgaacggtatggcaggtct
atgattcatgattttaacaatggaacggtgggctggacagattggaatattttattagac
gaaaatggggggccaaatcatgttcaaaatttttgttttgctccaatccatgccgatagt
cagtctggcaatttaatttatacaccaagttattattttttgggacatttttcaaaattt
attgataaaaatgctcatagagtaagcagtgttgctagtagaagccaactgcttacaacc
tcatttttgaatccaaacggcaaattgactaccattataatgaatgaaaccaatcaaaat
gtacagtattatttgtgtattggtgcaagtgctgtggctctcgatattttgccccatagt
attcaaacggtagttttttaa

DBGET integrated database retrieval system