KEGG   Flavobacterium branchiophilum: FBFL15_1418Help
Entry
FBFL15_1418       CDS       T01625                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
fbr  Flavobacterium branchiophilum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:fbr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1661989..1663905
Genome map
AA seq 638 aa AA seqDB search
MNKVLAHSLFSDFDISLFKAGKHFKLYEKLGAHLITIDGIQGVYFSVWAPSAKAVHVVGD
FNYWNNQEHPLNVRWDESGIWEGFIPGINKGALYKYSILSDINNVVTEKADPFGFYCEHP
PKTASVVWDLNYNWKDTNWIQNRKEHNALDKPFAVYEVHLGSWRRHTHDNSFLSYTELAV
ELVNYVKETGFTHVEFMPIMEYPYDPSWGYQLVGYFAPTSRFGNPQEFMFLVDQLHQAGI
GVILDWVPSHFPDDAHGLGYFDGSNLYEHPDRRKGYHPDWKSLVFNYGRNEVRAFLISNA
LFWLQHYHADGLRVDAVASMLYLDYSRKDGEWEPNIYGGRENLDTISFLKEFNEAVYLNF
PDTQTIAEESTSFPMVSKPTFVGGLGFGMKWMMGWMHDTLQYFQRDSIYRKYHQDELSFS
MTYCFTENFMLPLSHDEVVYGKQSIFEKMVGDEWQKFANLRLLYGYMYAHPGAKLLFMGS
EFGQSSEWQFDQSLDWHLLQFRSHNGIKQWITDLNQCYKSQPALYENQFDPAGFEWINYS
DHQNAVFSFIRKGKDIRNDLIVICNFTPVVRENYVIGIPQNGKLIEIMNSDNLQYGGSGV
VNFDPIQIVNTSRDGKPFSAALTLPPLGIVVCKIQNEV
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagttttagctcattctttattttcggatttcgatatttctttattcaaagca
ggaaaacattttaagctttacgaaaaattgggtgcccatctgattacaattgatggaata
caaggtgtatatttttcggtttgggcaccatcggcaaaagcagtacatgtagtaggcgat
tttaattattggaacaaccaagaacatcctttaaacgtccgatgggacgaatcaggtata
tgggaaggatttattcctggtataaataaaggagcattatacaagtacagtattttatct
gatataaataatgttgttacagaaaaagcagatccttttgggttttattgtgaacatcct
cctaaaactgcttcagtagtttgggatttaaattataattggaaagacacgaattggatt
caaaacagaaaagaacataacgctttagacaaaccatttgcagtatatgaagtacatttg
ggttcgtggagaaggcacacacacgacaatagttttttaagttatacagaattagccgta
gaattggtaaattatgtaaaagaaacaggatttactcacgtagaatttatgccaattatg
gaatatccttatgatccatcgtgggggtatcaattagttggctattttgcacccacatcg
cgatttggaaacccacaggaattcatgtttcttgtagatcaactacatcaagcgggtatt
ggtgtaattttagattgggttccttctcattttccagatgatgcccatggtttgggctat
tttgatgggtccaacttgtatgaacatccagataggcgaaaaggataccatcctgattgg
aaaagtttagtttttaattatggacgcaatgaagtaagagcatttttaatcagtaatgct
ttattttggttgcagcattatcatgcagacgggcttagagtagatgcggtagcctctatg
ttgtatttggattattccagaaaagatggagaatgggaacctaatatttatggaggaagg
gaaaacttagatactattagttttttaaaagaatttaatgaagctgtatatctcaatttt
cctgatactcaaactattgcagaggaaagcacttcgtttcccatggtttcaaaaccaaca
tttgtaggtggattgggatttggaatgaaatggatgatgggctggatgcacgatacttta
caatattttcagagagatagtatttatcgtaaataccatcaggatgaactcagtttttct
atgacttattgttttacagaaaattttatgttgccgttgtctcatgatgaagtagtatat
ggtaaacaatctatttttgaaaaaatggtaggagatgaatggcaaaagtttgcaaattta
cgacttttgtatggctatatgtatgcacatccaggagccaagttattgtttatggggtct
gaatttggacaaagttctgaatggcaattcgatcaaagtcttgattggcatttgctccaa
tttaggtcgcataatggcatcaaacaatggataaccgatttgaaccaatgttataaatcg
caaccagcactatatgaaaatcaatttgaccccgcaggttttgaatggatcaattatagt
gatcatcaaaatgctgtattttcatttataagaaaaggaaaagatattcgtaatgatttg
atagtaatttgtaattttacacccgttgttagagaaaattatgtaataggcattccgcaa
aatggaaaattaatagaaatcatgaacagtgataacttacaatatggtggaagtggtgtt
gtaaattttgatcctattcaaatagttaataccagtcgtgatggtaaaccattttcagcg
gctcttactttgccaccacttggtattgttgtttgtaaaatacaaaatgaagtataa

DBGET integrated database retrieval system