KEGG   Flavobacterium branchiophilum: FBFL15_1459Help
Entry
FBFL15_1459       CDS       T01625                                 

Definition
hypothetical protein
Organism
fbr  Flavobacterium branchiophilum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1714071..1716965)
Genome map
AA seq 964 aa AA seqDB search
MKAKIFFIILVFTTFCKAQVVNIPDNNLKTALLNHIPVIDLNSNGQIETSEAQLITDELI
LNNKSITNSTGIEAFINVKKINLSTNSLASTESSPLVFNTQLLLEELDLSNNNQILAINC
NQIIPLKKLFLDRDVSSVLLNSQTQLIELKCASATFQSLSAFNKALLQKLNIYIIETDYP
NLPLGTLNNLTEIYLDSYINGVVLNTFTGTIPNLYKISFNNISISSSISFSFLNNVREFS
LGGSCDYDYLYNKLYTLTNLKKLTLNSNWSFSPSFPGNLLNFSSNPQLEYIYIYLSASTG
DYLPINLASNVNLKHLELYSYNSSSISLNNNVLLENLVLQSSHQTSPINLTNNVNLKKLT
LRGITLSTIPAPYIINLSQNQLLEEVTIYDDYLNNINFGNVNTITKLNILESKLETINLT
SFSSLIDLNFNSIKDILEIDLNNSINLDSVTIKLATSSGNNIYPSNFVKLKNGSTESLVD
IQKYNSNLKLCIDENDTTTNWILTGDASSNFFSTYCNFTPGGVYNTISGKIRLDLNSNGC
DINDVTVNNIKVVIDDTIETGYTFTNSNGEYEFYTQSNSVTITPYPNINYFIQSPQFASV
NFLNQVQQQDFCVISNGIHNDLEISIIPLTPARPGFDSKYKIIYRNNGNQIQSGTTNLSY
DNNVLDFVSTTLALDSQSTNLLTWSFLNLLPFESREIEVIFNLNSPLETPPLNSGNVLTY
SASILGLTDENPIDNQVILNQTVVNSFDPNDKTCIEGTTITQNMVGEYVHYLIRFENTGT
FAAENIVVKDIIDQSKFEINSLQPISSSHPLKVRAVNNSIEFIFQNINLPFDDANNDGYV
AFKIKTKLNLVVGNTFSNSANIYFDYNFPIVTNNYTTTIQNTLGLQENDFINNISVYPNP
VKNILNFKTEHNVSKVEVYDIAGRILSSNSISENKIDLSELKTGNYILKLFTEKGIMNTK
IMKE
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaaaaatcttttttataattttagtttttacaactttttgtaaagctcaagta
gttaacatacctgataataatttaaaaactgcattattaaatcatattcctgtaattgat
ttaaattcaaatggtcaaatagaaacatccgaagcccagttaataacggatgaattaatt
ttaaataataaatctataacaaatagtactggtattgaggcttttataaatgttaaaaaa
attaatttgtctactaatagtcttgcttcaacagaaagttcaccattagtttttaatact
caattattgcttgaagagcttgatttatctaataataatcaaattcttgctatcaattgt
aaccaaattattccattaaaaaaattgtttttagacagagatgtttcaagcgtacttcta
aattctcaaacgcaattaattgaattaaaatgtgcttctgcaacctttcaatctttgagt
gcgtttaataaagcactacttcaaaaactaaatatttatataattgaaacagattatcca
aatttgccattaggtacattaaataatttgacagaaatatatttagatagctatattaat
ggagtagttctaaacacttttacaggcacaataccaaatttatataaaatttcttttaat
aatatttcaatatcaagttcaattagtttttcctttttaaataatgtaagagaatttagt
ttgggtggatcttgtgattatgactatttatataacaaattatatacactaaccaatttg
aaaaagttaacactaaattctaattggagttttagtccaagttttccaggtaatttatta
aatttttcaagcaatccgcagttggaatatatatacatttacctaagtgcttcaacaggt
gattatcttcccattaatctggcaagtaatgtaaatcttaaacatttagaactttatagt
tacaattctagttctatttctttaaacaacaatgttttattagagaatttagtattgcag
tctagccatcaaaccagtccaataaatttaacaaataatgtaaacctcaaaaaattgact
ctccgtggaattacattatcaactattcctgctccttacattataaatttatctcaaaat
cagttattagaagaagtgactatttatgatgactatttaaataatataaattttggaaat
gtaaatactatcactaaattaaatattttagaatcaaaacttgaaacaataaatctaact
tctttttctagtttaatagatctaaactttaattcaattaaagatattttagaaatagat
ttgaataatagtattaatcttgatagtgtgacgataaaacttgccacttcatctggaaat
aatatctatccgtctaattttgtgaaacttaaaaacggttcaacagaatccttagtcgat
attcaaaaatataattccaatttaaaattatgtatagacgagaatgatactacaaccaat
tggattttaactggggatgcatctagtaattttttcagtacttattgtaatttcactcct
ggtggtgtttataatacaatttcaggaaaaataagactcgacctgaattctaatggttgc
gatattaatgatgttactgttaataatattaaagtagtaattgatgacacaatagaaacg
ggatatacttttacaaactctaatggtgaatatgaattttacacccaaagtaatagcgta
actattactccatatccaaacataaattattttattcaatcgcctcaatttgcttcagtt
aattttttaaatcaagtacagcaacaagatttttgtgttatttctaacggtatccataat
gatttagagataagtatcatacctctaactcctgcaagacctggttttgattcaaaatat
aaaattatatataggaataatggtaaccaaattcaatcaggaactacaaatttatcatat
gataataatgtattagattttgtgtcaaccactctagcacttgatagtcagtctacaaat
ttattaacttggagttttttaaacttattaccatttgaaagtagagaaattgaagtcatt
tttaatcttaactctccattggaaactcctccattaaatagtggaaatgttttaacttat
tctgcttcaattttgggattaactgatgaaaatccaattgacaatcaagtaattttaaat
caaacagtggtaaattcattcgatccaaatgataaaacttgtatagaaggaacaaccatt
acacaaaatatggtcggtgaatatgttcattacttaatacgatttgaaaatactggaact
tttgcagcagaaaatattgttgtaaaagacattatcgatcaatcaaaatttgaaataaat
tcgctacaaccaatttcctctagtcatcctttaaaagttagagcagtaaataacagcatt
gaatttatttttcaaaacataaatcttccatttgatgatgctaacaatgatggttatgta
gcgtttaaaattaaaacaaaactaaatttagttgttggaaatacttttagcaattcagca
aatatctattttgattataatttcccaatagttacaaataattatacaacaacaattcaa
aacacattgggtttacaagaaaatgattttattaataacatttctgtatatccaaaccct
gtaaaaaatattttaaatttcaaaacagaacataatgtttcaaaagttgaagtttacgat
attgcaggaagaattttaagttcaaattcgatttctgaaaataaaattgatttgagcgaa
ctaaaaacaggtaattatattcttaaactttttactgaaaaaggaataatgaacactaaa
ataatgaaagaataa

DBGET integrated database retrieval system