KEGG   Flavobacterium branchiophilum: FBFL15_1632Help
Entry
FBFL15_1632       CDS       T01625                                 

Gene name
folE2
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
fbr  Flavobacterium branchiophilum
Pathway
fbr00790  Folate biosynthesis
fbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FBFL15_1632 (folE2)
Enzymes [BR:fbr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     FBFL15_1632 (folE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: CCB69695
UniProt: G2Z1C9
Position
complement(1918893..1919564)
Genome map
AA seq 223 aa AA seqDB search
MKNAENFNDEIGNNHIATNAQNPIRPDAFVLSDEEKIESIKKDVTNILQTLGMDLTDDSL
KGTPNRVAKMFVNEIFGGLNPNKKPSASTFENNYKYGEMLVEKNIVVYSTCEHHLLPIIG
RAHVAYISNGTVVGLSKMNRIVEYYAKRPQVQERLTMQIVQELQKVLNTDDVACVIDAKH
LCVNSRGIKDIESSTVTSEFGGKFKNEQTKREFLDYIKFDTKF
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgctgaaaatttcaacgacgaaataggtaataatcatattgcaacaaatgct
caaaatcccatcagacccgatgcctttgtactttcagacgaagaaaaaattgaatctata
aaaaaagacgtaacaaatatattacaaactttaggtatggatttaacagacgacagtttg
aaaggaacaccaaatagggtagcaaaaatgtttgttaatgaaatatttggtggattaaat
ccaaacaaaaaaccaagcgcttcaacttttgaaaacaattacaaatatggagaaatgttg
gtcgaaaaaaatattgtagtctattctacctgcgaacaccatttattgcccattattggt
cgagcacatgtagcttatatcagcaacggcacagtagttggactttcaaaaatgaacaga
attgtagaatattatgcaaaaagaccacaagttcaagagcgtttgactatgcaaattgtt
caagaactacaaaaagtattaaacaccgatgacgtagcctgtgtaatagatgccaaacat
ttatgtgtcaattcaagaggtatcaaagacatagaaagcagcacggttacctcagaattt
ggtggaaaattcaaaaatgaacaaaccaaacgagaatttttagattatataaaatttgat
acaaaattttaa

DBGET integrated database retrieval system