KEGG   Flavobacterium branchiophilum: FBFL15_1883Help
Entry
FBFL15_1883       CDS       T01625                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fbr  Flavobacterium branchiophilum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fbr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FBFL15_1883 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FBFL15_1883 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FBFL15_1883 (trpA)
Enzymes [BR:fbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FBFL15_1883 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2213882..2214643
Genome map
AA seq 253 aa AA seqDB search
MNRIKQKLQENKKILSIYFSAGYPNLNDTVAIIQDLEKNGVDLIEIGLPFSDPLADGPTI
QESSTKAIENGMTTVKLFEQLSNIRQSVQIPLIIMGYFNPIMQYGVAAFCEKCAEIGIDG
LIIPDLPVDIYAQNYQSIFEKHGLLNIFLITPQTSDDRIRYIDSVSEGFIYMVSSASVTG
SQTGFGLEQEAYFERIANMNLNNPQIVGFGISDAATFNQATKQAKGAIIGSAFIKYITQH
GIQNVGQFIKTIR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaataaaacaaaaattacaagagaataaaaaaatactttcaatatatttttct
gctggataccccaatttgaacgatacggttgcaataattcaggatttagaaaaaaatggt
gttgatctgatagaaattgggttgccttttagcgatccattggccgatggccctaccatt
caagaaagttctacaaaagccatagaaaacggcatgacgactgtcaaattatttgaacaa
ttatcaaacataagacaatctgtacaaataccattaatcatcatggggtattttaatcca
atcatgcaatatggcgtagcggcattttgcgaaaaatgtgccgaaattggcattgatggg
ttaattattcccgatttacccgtagatatttatgctcaaaactatcaatccatttttgaa
aaacatggattgttgaatatttttttgatcacaccacaaacatcagacgaccgcatacga
tatatagatagtgtttcggaaggattcatttatatggtaagttctgcaagtgttacggga
tctcaaacaggttttggattggaacaagaggcttattttgaaagaattgcaaatatgaat
ttgaataacccgcaaattgttggctttggaataagtgatgctgcaacatttaatcaagca
acaaaacaggcaaaaggagctattattggcagtgcatttatcaaatatatcacccaacat
ggcatccaaaatgtaggacaatttattaaaacaatccgataa

DBGET integrated database retrieval system