KEGG   Flavobacterium branchiophilum: FBFL15_1971Help
Entry
FBFL15_1971       CDS       T01625                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
fbr  Flavobacterium branchiophilum
Pathway
fbr00020  Citrate cycle (TCA cycle)
fbr00640  Propanoate metabolism
fbr00660  C5-Branched dibasic acid metabolism
fbr01100  Metabolic pathways
fbr01110  Biosynthesis of secondary metabolites
fbr01120  Microbial metabolism in diverse environments
fbr01130  Biosynthesis of antibiotics
fbr01200  Carbon metabolism
Module
fbr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fbr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fbr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FBFL15_1971 (sucC)
   00640 Propanoate metabolism
    FBFL15_1971 (sucC)
   00660 C5-Branched dibasic acid metabolism
    FBFL15_1971 (sucC)
Enzymes [BR:fbr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     FBFL15_1971 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 DUF2711
Motif
Other DBs
NCBI-ProteinID: CCB70014
UniProt: G2Z259
Position
2308892..2310085
Genome map
AA seq 397 aa AA seqDB search
MDIHEYQGKEILASYGVKVQRGYVANNPQEAVAAAKQLTAETGTGWHVIKAQVHAGGRGK
GGGVKLAKNLEQVEQLAEQIIGMQLITPQTSAEGKKVHKVLVAEDVYYPGESETSEFYMS
VLLNRGKGRNMIMYSTEGGMDIEEVAEHTPHLIFTEEIDPTVGLQAFQARRIAFNLGLSG
TAFKEMVQFVGALYNAYIGSDASMFEINPVLKTSDNKIIAVDAKVNLDDNALYRHPALAE
MRDVREENPIEVEAKAAGLNYVDLDGTVGCMVNGAGLAMATMDLIKYAGFEPANFLDVGG
TADAKRVELAFRIILKDPNVKAILINIFGGIVRCDRVAQGVVDAYKNMGDAIKVPIIVRL
QGTNAEIAKELIDNSGMPILSAVQFQEAADQVQKALS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggacatacacgaatatcaaggtaaagaaattttggccagctatggcgtaaaagttcag
cgaggttatgtggcaaacaacccacaagaagccgtagccgctgcaaaacaattaacagcc
gaaacaggaacaggctggcatgttatcaaagctcaagtacacgcaggtggtcgtggaaaa
ggtggcggtgttaaacttgcaaaaaatttagaacaagtggagcaattagcagaacaaatt
attggaatgcaattgattacacctcaaacctctgccgagggtaaaaaagtacacaaagta
cttgtggctgaagatgtttattatccaggcgaaagcgaaacttctgaattttatatgtca
gttttattaaatagaggtaaaggccgcaacatgattatgtactctaccgaaggtggaatg
gatatagaagaagtggcagaacatactcctcatttaatatttactgaagaaatcgaccca
actgttggtttacaagcttttcaagccagaagaattgcatttaatttaggtttatctgga
actgcatttaaagaaatggtgcaatttgtaggtgctttatacaatgcttatataggttct
gatgcttcgatgtttgaaattaatcctgttttgaaaacatctgacaacaagattattgct
gttgatgctaaagtgaatttggacgacaatgccctttacagacaccctgctcttgccgaa
atgagagacgttcgtgaagaaaaccctatcgaagttgaagctaaagccgctggattgaac
tatgtagatcttgacggaactgtaggttgtatggtaaacggtgctggattggcaatggct
accatggatttgataaaatatgctggttttgagcctgctaactttttggacgttggagga
actgcagatgccaaacgtgtagaactagcctttagaattatcctaaaagatccaaacgta
aaagctattttaatcaatatttttggtggaattgtacgttgcgaccgtgtagctcaaggg
gtagttgatgcttacaaaaacatgggagatgctattaaagtgcctattattgttcgtttg
caaggtaccaatgctgaaattgctaaagaattaattgacaattctggtatgcctatatta
tcggctgttcaatttcaagaagcggcagaccaagttcaaaaagctttgtcttaa

DBGET integrated database retrieval system