KEGG   Flavobacterium branchiophilum: FBFL15_2068Help
Entry
FBFL15_2068       CDS       T01625                                 

Gene name
proB
Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
fbr  Flavobacterium branchiophilum
Pathway
fbr00330  Arginine and proline metabolism
fbr00332  Carbapenem biosynthesis
fbr01100  Metabolic pathways
fbr01130  Biosynthesis of antibiotics
fbr01230  Biosynthesis of amino acids
Module
fbr_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:fbr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    FBFL15_2068 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    FBFL15_2068 (proB)
Enzymes [BR:fbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     FBFL15_2068 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: CCB70098
UniProt: G2Z2D8
Position
2429012..2429773
Genome map
AA seq 253 aa AA seqDB search
MSKKRILLKIGSNTLTKESNHISRGKIEDIGVQIAALQNDFEFIIVSSGAIAAAKQFVKL
DNNDKDVFVKQALASIGQPHLMRIYHENFSDLGLHISQCLLSYSDFEKKQSKTNIVNTIN
VLVQNNYIPIINENDTVATDEIKFGDNDKLAALTAVLLQADLLIIATNTNGIYTKKSINH
SIPETIKIVTDLSLLQQEVGDSKSTHGTGGMQSKIDATAIAKAAHIETWIVNGLEDNFII
KALNNEINFTKII
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagaaaagaattttattaaaaattggtagcaacacgcttaccaaagaaagcaac
catatatcgagaggtaaaatcgaggatattggcgttcaaattgccgctttgcaaaacgat
tttgaatttattattgtaagttcgggggccattgctgcagccaaacaatttgtaaagcta
gacaacaatgacaaagatgtttttgtaaaacaagcattagcctctattggccagccccat
ttgatgcgaatttatcatgaaaattttagcgatttaggactacatatttctcaatgtttg
ctttcttattctgattttgaaaaaaaacaatctaaaaccaacatcgtcaatacgataaat
gttttggtacaaaataattatattccaattataaacgaaaatgacaccgttgccacagac
gaaatcaagtttggcgacaacgacaagttggccgccctaactgccgttttgttgcaagcc
gatttattgatcattgccaccaataccaatggaatttatactaaaaaatccataaaccac
tccatacctgaaaccatcaaaattgttacagatttaagcctcctgcaacaagaggtaggc
gacagcaaatcgactcatggcacgggtgggatgcaatcgaaaattgatgccacagccatt
gcaaaagcagcccatatcgaaacatggattgttaacggattggaagataattttatcata
aaagctttaaataatgaaattaattttacaaaaataatataa

DBGET integrated database retrieval system