KEGG   Flavobacterium branchiophilum: FBFL15_2078Help
Entry
FBFL15_2078       CDS       T01625                                 

Definition
putative cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
fbr  Flavobacterium branchiophilum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2439147..2440319
Genome map
AA seq 390 aa AA seqDB search
MKKILLLIPIFHILCSCNKSEDYQEVETYPNVKAAFGNKIDLTNLYNYANQTVPAYITKN
NVGGNPITDKGATLGRVLFYDKNLSSNNTISCASCHIQANAFSDPVVASVGVNGTTGRHA
MRLINTRFANETKFFWDERASSLEIQTTQPIQNHIEMGFSGTNGDGTMATVIAKLQNIGY
YKELFKFVYGSETITESKIQLALAQFIKSIQSFDSKYDAGRALVANDGQNFPNFTTQENL
GKNIFLTPPVFDATSTRTSGGFGCAGCHAAPEFDIDPNTKNNGIVGTIGSNVLDLTNTRA
PSLRDLVNQAGNPNSPMMHTGVITTLNAAIGHYGTINTPPGNTNLDPRLKPNGVGQKLNV
TATEVQAVVAFLKTLSGNNVYTDPKWSNPF
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattttattgctcatacccatttttcatattttatgctcctgtaataaaagt
gaagattatcaagaagtagaaacctatccaaatgtaaaagctgcttttggaaacaaaatt
gacttgaccaatttatacaattatgccaatcaaactgttcctgcctatattactaaaaac
aatgttggtggcaatccgataactgacaaaggagctactctgggtcgggttttattttat
gacaaaaatttatcttcaaacaataccatttcatgtgccagttgtcatattcaggccaat
gctttttcagatccagtagtagcaagtgttggtgtaaatggtactacgggtcgccatgcc
atgcgacttatcaatacacgatttgccaacgaaaccaagtttttttgggacgagcgtgct
tcttcattagaaattcaaactacgcaaccgattcaaaatcatatcgaaatgggatttagt
ggcaccaatggcgatggcactatggctactgtaattgcaaaactgcaaaacattggctat
tataaagaactctttaaatttgtatatggatctgaaaccattacggaatccaaaatacaa
ttggcattagcacaatttatcaaaagtatccaatcctttgactcaaaatatgatgcaggc
agagcattagttgccaatgatggccagaattttccaaattttacaactcaagaaaatctg
ggtaaaaacatatttcttacacctcccgtttttgatgctacaagtaccagaacaagtggc
ggttttggttgtgcaggttgccatgcagcaccagaatttgacatagatcccaacactaaa
aacaatggaatagtaggaacaattggcagtaatgttttggatttgaccaataccagagca
ccttcgttacgagatttggttaaccaagctggtaacccaaattcgccaatgatgcacaca
ggagtaatcactacgctaaatgctgcaattggtcattatggtaccataaacacacctcca
ggcaataccaatttagaccctcgattgaaaccaaatggtgttggacaaaaattaaatgtt
acggcaactgaagtacaagccgttgttgcattcctaaaaacgctttcaggtaacaatgtt
tatacagacccgaaatggtctaatcctttttaa

DBGET integrated database retrieval system