KEGG   Flavobacterium branchiophilum: FBFL15_2214Help
Entry
FBFL15_2214       CDS       T01625                                 

Definition
putative cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
fbr  Flavobacterium branchiophilum
Brite
Enzymes [BR:fbr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     FBFL15_2214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2576850..2577887)
Genome map
AA seq 345 aa AA seqDB search
MKTKIILLLILPLLWSCTNDDEDYTNLPLEFKVPSNFPPLAYNISNNPPTQKGFELGKKL
FYDGRLASDGVVSCGFCHIQENAFTHHGHTFSHGVNDAVGTRNTPSIQNLGYQTSFMWDG
AVNHLDLQSILPFTNPVEMNGDFSAAITMMKGDAEYQKLYKLAFADGQINSENMLKALGQ
FMLMVTSSNSRFDKYRRNEAGGDLTQQELSGYAIFNQKCASCHATDLFTDNSFRNNGLSV
NPALNDVGRYRVTELDQDLHKFKVPSLRNVEKTAPYMHDGRLLTLEGVLDHYSSEVIDSA
TLDPILKQNGTLGIALSVTEKSALIAFLKTLTDTQYLTDKRFSEY
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaaaataatattgttgctcattttacctttgctatggagttgtaccaacgat
gacgaagattacaccaatttgcctttagagtttaaagttccttcaaattttccgccatta
gcatataatatttcaaataatccgcctacgcaaaaaggttttgagctgggtaaaaaattg
ttttatgacggtcgattggcatcagacggtgtggtttcgtgtggtttttgtcatattcaa
gaaaatgcttttacgcaccacggacacacttttagtcatggtgtaaacgatgctgtaggt
acaagaaatacgccttctattcaaaatttgggctatcaaacttcttttatgtgggatgga
gccgtcaatcatttggacttgcaatcaattttgccttttacaaatccggtagaaatgaat
ggcgattttagtgctgctataactatgatgaaaggcgatgccgagtatcaaaagttatat
aaattggctttcgccgatggacaaatcaactctgaaaacatgctcaaagccttgggacaa
ttcatgctgatggtaacttcatccaactctcgttttgataaataccgacgcaatgaagca
ggaggtgacttgacgcagcaagagttgagtggttatgccattttcaatcaaaaatgtgcc
agttgtcatgcaaccgatttgtttaccgataattcttttagaaataacggcttgtctgtc
aatcctgccctgaatgatgtgggacgctatagagtaaccgaactcgaccaagacttgcac
aagtttaaagtaccaagccttcgaaacgtagaaaaaacggcaccttacatgcacgatgga
cgattgctcaccttagaaggtgtattggatcattacagctcagaggttatagattctgca
acattagacccaattctaaagcaaaatggaactttgggaattgccttgtctgtcactgaa
aaatcagcattaattgcttttctaaaaacattaacagatacacaatatttaaccgataaa
cgattttcggaatattaa

DBGET integrated database retrieval system