KEGG   Flavobacterium branchiophilum: FBFL15_2398Help
Entry
FBFL15_2398       CDS       T01625                                 

Gene name
pdhC
Definition
(GenBank) Pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fbr  Flavobacterium branchiophilum
Pathway
fbr00010  Glycolysis / Gluconeogenesis
fbr00020  Citrate cycle (TCA cycle)
fbr00620  Pyruvate metabolism
fbr01100  Metabolic pathways
fbr01110  Biosynthesis of secondary metabolites
fbr01120  Microbial metabolism in diverse environments
fbr01130  Biosynthesis of antibiotics
fbr01200  Carbon metabolism
Module
fbr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FBFL15_2398 (pdhC)
   00020 Citrate cycle (TCA cycle)
    FBFL15_2398 (pdhC)
   00620 Pyruvate metabolism
    FBFL15_2398 (pdhC)
Enzymes [BR:fbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     FBFL15_2398 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3 Sigma54_activ_2
Motif
Other DBs
NCBI-ProteinID: CCB70406
UniProt: G2Z3F7
Position
complement(2813927..2815513)
Genome map
AA seq 528 aa AA seqDB search
MATIITMPRLSDTMTEGTVASWLKKVGDTISEGDILAEIETDKATMEFESFNSGTLLYIG
IPEGESAPIDALLAIIGNEGEDISGLIGGQTAAPLQDTPMVANEAPAAAKTALPNGVIVV
TMPRLSDTMTDGTVATWLKKVGDTISEGDILAEIETDKATMEFESFNSGTLLYIGIAAGE
SAPVDSLLAIIGPAGTDVSGVAQNFGQAPSSPVAATTETPVQAVPVVAQNASTERVLASP
LAKKIAADKGVNLSQIKGSGENGRIVKSDVENYSPAPQAAPAVVAEKKAETQNSKPFVAS
GTVATEEIKNSQMRKVIAKRLSESIFTAPHFYLTIEVAMDEAMNSRVIINSIPDTKISFN
DMVIKACAMALKKHPKVNSQWSENAITINYHVAIGVAVAVEDGLVVPVLPFTDSMSLTQI
GSSVRDLAGKAKNKKLQPSEMEGSTFTISNLGMFGITEFTSIINQPNSAILSVGAIVEKP
VVRNGQIVVGNTMKLTLACDHRTIDGATGAQFLQTLKQFIENPVTMLA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaattataactatgccgcgactaagcgatactatgacggaaggaacagtagca
tcgtggctaaaaaaagtaggcgataccatttctgaaggcgatattttagcagaaattgaa
acagataaagccaccatggaatttgaatcttttaactctggaacacttttgtatatagga
attccagaaggggaatcggcaccaatagatgcccttttggccattattggcaacgaaggc
gaagatatttcagggctgattggcggtcaaactgcagctccattgcaagacacacccatg
gtagcaaacgaagctcctgccgctgcaaaaacagcattacccaacggtgttatcgttgta
accatgcctcgattgagcgacaccatgaccgatggaactgtagccacgtggcttaaaaaa
gtaggcgataccatttctgaaggcgatattttagcagaaattgaaactgataaagccacc
atggaatttgaatctttcaactctggtactttattatacattggcattgcagctggagag
tcggcacctgtggacagccttttagctattattggccctgctggaacagatgtatctgga
gttgctcaaaattttggacaagcaccatcaagtcctgttgctgccactaccgaaactcca
gttcaagcggtacctgttgtagcccaaaatgcttctaccgaaagggttttggcatcgcca
ttggctaaaaaaattgcggctgataaaggggtaaacttgagccaaatcaaagggtcgggc
gaaaatggcagaattgttaaaagtgatgtagaaaattatagcccagcaccgcaagcagca
cctgctgttgttgcagaaaaaaaggccgaaactcaaaatagcaaaccatttgtagcttcg
gggactgtggcaacggaggaaattaaaaattcgcaaatgcgaaaagtaattgccaaacga
ctttcggaatcgatttttacagcacctcatttttatttgacaatagaagttgccatggac
gaggcaatgaactctagggttatcatcaattctattccagatacaaaaatttcttttaat
gatatggttatcaaagcttgtgctatggccttgaaaaaacatccaaaagtaaattctcaa
tggagcgaaaatgcgattaccatcaattatcatgtggctattggtgtagccgtagccgta
gaagacggattggtagttccggtattaccatttacagacagtatgagccttactcaaatt
ggaagtagtgttcgagatttggctggcaaggccaaaaataaaaaattacaaccttctgaa
atggaaggcagtacatttacaatttctaacttaggcatgtttggtattaccgaatttaca
tctattatcaatcagccaaattctgccatcttatcggtgggggcaattgtagaaaaacca
gttgtaagaaatggacaaatagttgttggcaacaccatgaaattgacgttggcttgtgac
caccgtaccatagacggtgctacgggagcacaatttttgcaaacattaaaacaatttata
gaaaatccagttactatgttggcataa

DBGET integrated database retrieval system