KEGG   Flavobacterium branchiophilum: FBFL15_2593Help
Entry
FBFL15_2593       CDS       T01625                                 

Gene name
leuD
Definition
3-isopropylmalate dehydratase small subunit (EC:4.2.1.33)
Orthology
K01704  
3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.35]
Organism
fbr  Flavobacterium branchiophilum
Pathway
Valine, leucine and isoleucine biosynthesis
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:fbr00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    FBFL15_2593 (leuD)
   01230 Biosynthesis of amino acids
    FBFL15_2593 (leuD)
  Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    FBFL15_2593 (leuD)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    FBFL15_2593 (leuD)
Enzymes [BR:fbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     FBFL15_2593 (leuD)
    4.2.1.35  (R)-2-methylmalate dehydratase
     FBFL15_2593 (leuD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3025365..3025949
Genome map
AA seq 194 aa AA seqDB search
MEKFIKLKSKAVPLPIENIDTDQIIPARFLKVTDKVGFGNHLFKDWRFDDHNLPITSFVL
NNNDYSGAILVAGDNFGCGSSREHAAWALADYGFKVVVSSYFADIFKGNALNNGILPILV
SPDFLKQIFDHIQADSQTNLIVDLENQEIAIENTPLKEPFEIDPYKKICMINGFDDIDFL
ISKKAEIEAFEKNR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatttataaaattaaaatcaaaggctgtacctttacctatcgaaaacattgat
acagaccaaattataccagctcgttttctaaaggtaacagacaaagtaggttttggtaat
catttattcaaagattggcggtttgacgatcataacctacccataacttcattcgtattg
aacaacaacgactattcgggtgccattttggttgcaggagacaattttgggtgtggcagt
agccgagaacatgccgcttgggccctagccgattatgggttcaaagtagtggtatctagc
tattttgccgatatttttaaaggtaatgccctcaacaacggcattttacccatactcgtt
tcgccagatttccttaaacaaattttcgatcatattcaagcagatagtcaaaccaatttg
attgttgatttagaaaaccaagaaattgctatcgaaaacaccccattaaaagaacctttt
gaaatagatccttataaaaaaatatgtatgatcaatggatttgatgacatcgatttttta
ataagcaaaaaagccgaaatagaggcttttgaaaaaaacagataa

DBGET integrated database retrieval system