KEGG   Flavobacterium branchiophilum: FBFL15_2593Help
Entry
FBFL15_2593       CDS       T01625                                 

Gene name
leuD
Definition
3-isopropylmalate dehydratase small subunit (EC:4.2.1.33)
Orthology
K01704  
3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.35]
Organism
fbr  Flavobacterium branchiophilum
Pathway
Valine, leucine and isoleucine biosynthesis
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:fbr01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:fbr01230]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:fbr00660]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:fbr00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3025365..3025949
Genome map
AA seq 194 aa AA seqDB search
MEKFIKLKSKAVPLPIENIDTDQIIPARFLKVTDKVGFGNHLFKDWRFDDHNLPITSFVL
NNNDYSGAILVAGDNFGCGSSREHAAWALADYGFKVVVSSYFADIFKGNALNNGILPILV
SPDFLKQIFDHIQADSQTNLIVDLENQEIAIENTPLKEPFEIDPYKKICMINGFDDIDFL
ISKKAEIEAFEKNR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatttataaaattaaaatcaaaggctgtacctttacctatcgaaaacattgat
acagaccaaattataccagctcgttttctaaaggtaacagacaaagtaggttttggtaat
catttattcaaagattggcggtttgacgatcataacctacccataacttcattcgtattg
aacaacaacgactattcgggtgccattttggttgcaggagacaattttgggtgtggcagt
agccgagaacatgccgcttgggccctagccgattatgggttcaaagtagtggtatctagc
tattttgccgatatttttaaaggtaatgccctcaacaacggcattttacccatactcgtt
tcgccagatttccttaaacaaattttcgatcatattcaagcagatagtcaaaccaatttg
attgttgatttagaaaaccaagaaattgctatcgaaaacaccccattaaaagaacctttt
gaaatagatccttataaaaaaatatgtatgatcaatggatttgatgacatcgatttttta
ataagcaaaaaagccgaaatagaggcttttgaaaaaaacagataa

DBGET integrated database retrieval system