KEGG   Flavobacterium branchiophilum: FBFL15_2660Help
Entry
FBFL15_2660       CDS       T01625                                 

Definition
putative pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
fbr  Flavobacterium branchiophilum
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fbr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FBFL15_2660
   00500 Starch and sucrose metabolism
    FBFL15_2660
Enzymes [BR:fbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     FBFL15_2660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3103575..3104582)
Genome map
AA seq 335 aa AA seqDB search
MIVNFKKATPILIIIFFLLGVKGFSNCFKVKNTDFYKIVAQDGTGDYVSIQAAINDCASF
PNERITIFIKNGVYKEKIKVNEWNTNIILLGESRANTIITHDDNFNKMGVGKNSTFLTYT
LLIESNDVILKNLTIENASGAIGQAIALSVISDNVMVVDCNIIGNQDTLYASGKGRQYYK
NCTIEGTTDFIFGNATAYFDCCEIKSKKNSYITAASTPEESKYGFVFQSCHFIADSNATK
VYLGRPWRIYAKTVLLNCILEKHIDPEGWHNWSKPEAEKTTFYAEFQSVGDGSNTNNRVQ
WSHQLNQIEAKKYEMKQCLGTDFFNTIQKFLKNEK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgattgtcaatttcaaaaaagcaactcccattcttatcatcatcttttttttacttggg
gtgaaagggttttccaattgctttaaagtaaagaacactgatttttataaaattgtggct
caagatggcaccggtgattatgtctctatccaagctgcaataaatgattgtgcatctttt
cctaatgaaagaattacaatttttattaaaaacggagtttataaagaaaaaataaaagtc
aatgaatggaataccaatatcatattattaggcgaaagtagagcaaatacaatcataacc
catgatgacaatttcaataaaatgggtgttggaaaaaacagtacttttttaacctatact
ttactaattgaaagtaatgatgtgatattaaaaaatttgacaatcgaaaacgcgtctggt
gcaattggtcaagcaatagctttgtctgttatttctgacaacgttatggttgtagattgc
aatattattgggaatcaagatacattatacgcctctggcaaaggaaggcagtattataaa
aattgtactattgaaggtactaccgactttatttttggtaatgcaaccgcttattttgat
tgttgcgaaatcaaatcaaagaaaaactcctatattacagcagcttcaactcccgaagag
tcaaaatatggttttgtttttcaatcatgtcattttattgcagattcaaatgccacaaaa
gtatatcttggaagaccatggcgaatttatgcaaaaacagtccttttgaattgtattctt
gaaaaacatattgatccagaaggctggcacaattggtcaaaaccagaagcagagaaaaca
actttttatgccgagtttcaatccgttggagatgggtctaatacaaataatagagtacaa
tggtcgcatcaattgaatcaaatagaggcaaagaaatatgaaatgaaacagtgcttagga
accgatttttttaatacgattcaaaaatttttaaaaaatgaaaaataa

DBGET integrated database retrieval system