KEGG   Flavobacterium branchiophilum: FBFL15_2705Help
Entry
FBFL15_2705       CDS       T01625                                 

Gene name
speB
Definition
Agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
fbr  Flavobacterium branchiophilum
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:fbr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    FBFL15_2705 (speB)
Enzymes [BR:fbr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     FBFL15_2705 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3162136..3163218
Genome map
AA seq 360 aa AA seqDB search
MTKQEKILNFDPSQPGLADESIFGLPFSADESEIIIIPVPWEVTVSYGSGASEGPEAVLN
ASFQVDLHHQEFPNLWKQGIYLDLNDQTQKWATDSNKFKSMAQPIIDALTAGEVIESLPA
LQSDLDKINKACKDLNEEVKQRTLYWLKKGKKVALLGGDHATPLGYYQALATKYDNFGIL
HLDAHMDLRIAYEGFTYSHASIMYNALQIPQISKIVQIGIRDFCKQEAETALSERVCVHT
DMDLKSAQFKGTTWHDQCLQIIASLPNNVLISFDIDALYTWYCPNTGTPVPGGISFEQAT
YLLSLLASSDKCIIGFDLVEVAPGNDDWDGNVGARLLYHLCGVISKNNHLDVGQTIQFKK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgactaaacaagaaaaaattctaaattttgatccctcacaaccaggcttggcagacgag
agtatttttgggctaccattttcggcagatgaaagtgaaattatcattattccagtgccg
tgggaagtaactgttagttatggatctggagcttcagaagggccagaggcagtgctaaat
gcctcgtttcaagtagatttacaccatcaagagtttccaaatttatggaaacaaggtatt
tatttagaccttaatgatcaaactcaaaagtgggccacagacagtaataaattcaaatct
atggcacagcccattatagatgctctaacagctggcgaagtaattgaaagtttgccagca
ttgcaatctgatttggataaaatcaataaagcctgcaaagatttgaacgaagaggtaaaa
caacgtaccttatattggttaaaaaaaggcaaaaaagtagcccttttgggtggcgaccat
gctacaccattaggatattatcaggccttggcaaccaagtatgataattttgggatttta
cacctagatgctcacatggatttgcgaattgcttatgaggggttcacatattctcacgca
tcaataatgtacaatgctttgcaaattcctcaaatttcaaaaattgttcaaattggcatt
cgtgatttttgcaaacaagaagcagaaactgcccttagcgaaagagtgtgtgtgcatacg
gatatggatttaaaatcggcacaattcaaaggtacaacctggcacgatcaatgtttgcaa
atcatagcttcgttacccaacaatgtgttaataagttttgatattgatgctttatacaca
tggtattgccccaatacaggaactcctgtaccaggcggcatttcatttgaacaagcaaca
tacttactaagtctattggcttcgtctgacaaatgtattattggattcgacttagtagaa
gtggcacctggcaacgatgattgggatggcaatgtgggagcaagattgttgtatcactta
tgcggtgttatatcaaaaaacaatcatttggatgttggtcagacgattcagttcaaaaaa
taa

DBGET integrated database retrieval system