KEGG   Flavobacterium branchiophilum: FBFL15_3013Help
Entry
FBFL15_3013       CDS       T01625                                 

Gene name
gmk
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
fbr  Flavobacterium branchiophilum
Pathway
fbr00230  Purine metabolism
fbr01100  Metabolic pathways
Module
fbr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:fbr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FBFL15_3013 (gmk)
Enzymes [BR:fbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     FBFL15_3013 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_19 AAA_16 AAA_22 ABC_tran RsgA_GTPase cobW AAA AAA_28 CPT TsaE RNA_helicase Herpes_BLRF2 AAA_30 AAA_17 Viral_helicase1 KRTDAP
Motif
Other DBs
NCBI-ProteinID: CCB70957
UniProt: G2Z6D7
Position
complement(3478830..3479411)
Genome map
AA seq 193 aa AA seqDB search
MQKGKLIVFSAPSGSGKTTIVKHLLEHENLNLEFSISAATRQARGEEENGKDYYFMSLEQ
FKHHIKNEDFVEWEEVYRDNFYGTLKSEVTRIWDKGKNVIFDIDVAGGLRIKSKFPDETL
AVFVKPPSVDELKRRLKERSTESDEKINMRIAKAHVELATAPQFDTIIKNYDLETAKKEA
YKLVLDFINNELI
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaggaaaacttatcgttttttctgctccttcaggttcaggaaaaacaacaatt
gtaaaacatttgttggaacacgaaaatttaaacttagaattctccatctcggcagcaact
cgacaggctaggggagaggaggaaaacggtaaagattattattttatgtcgttagaacaa
tttaaacaccacatcaaaaacgaagattttgtagaatgggaagaagtgtatagagacaat
ttttatggcacgctaaaaagcgaagtaacccgaatttgggacaaaggaaaaaatgttatt
tttgatatagatgttgcgggtggtttacgaatcaaatctaaatttcctgatgaaaccttg
gcagtttttgtaaaaccaccaagcgttgatgaattgaaacgacgactcaaagaacgctct
accgaaagcgatgaaaaaatcaatatgcgaattgcaaaagcccatgtagagctggcaaca
gcaccccaatttgataccataattaaaaactatgatttggaaaccgccaaaaaagaagcg
tataaacttgttttagattttattaataatgaattgatttaa

DBGET integrated database retrieval system