KEGG   Felis catus (domestic cat): 100113473Help
Entry
100113473         CDS       T02385                                 

Gene name
PRF1, perforin
Definition
perforin 1 (pore forming protein)
Orthology
K07818  
perforin 1
Organism
fca  Felis catus (domestic cat)
Pathway
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100113473 (PRF1)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    100113473 (PRF1)
   05330 Allograft rejection
    100113473 (PRF1)
   05332 Graft-versus-host disease
    100113473 (PRF1)
  Cardiovascular diseases
   05416 Viral myocarditis
    100113473 (PRF1)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100113473 (PRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
D2
AA seq 555 aa AA seqDB search
MGACVLLPGLLLLLLPRPAPAPCHTAARSECRRNRPFVPGSMLAGEGVDVTSLRRSGSFP
VDTESFLRPDGTCTLCHNVLKQGALQRLPLALTDWRAQGSGCQRQVVRAKASSTEAVARE
AASNIRNDWRVGLDVSPKPSANVHVTVAGSHSHMANFAAQKTFHDQYSFSTDLVECRFYS
SHLVHSPPLHPNFQRVVRDLPPDFNTSTEADYLRLISNYGTHFIRSMELGGRISALTALR
TCELALDGLGAKEVEDCLAVEAQVSISGRADSSSELKACEEKKKHHKITTSFHQAYRERF
SEIVGGHHTSVSDLLFGDQAGPEQFSAWVASLLDRPSLVDYTLEPLHVLLESQDPRREAL
RQAVSKYVMDRARWKDCSRPCPLGQKKSPHNPCQCVCHGSAVTNQDCCPRQRGLAHLEVM
NFQASGLWGDSFTRTDAYLKVFFGGQELRVGTVWNDNNPKWMTRLDFGDVILSTGGPLRV
QVWDQDHGWDDDLLGTCDQNPRSGLHEVRCGLSHGHLRFSYHAKCLPHLKGATCLEYAPH
GLLGELPGNRSGPVW
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcctgcgtgctcctcccaggcctcctcctcctgctgctgccccgccccgcccca
gccccctgccacacggccgcccgctccgagtgccgccgcaaccgtccgtttgtgcccggc
tcaatgctggctggggagggcgtggacgtgaccagtctcaggcgctcgggctccttcccg
gtggacacagagagcttcctgcggcccgacggcacctgcactctctgccacaacgtcctg
aaacagggcgcccttcagcgcctccctctggcactgactgactggcgcgcccagggctca
ggctgccagcgccaagtggtcagggccaaggccagttccaccgaggccgtggccagggaa
gcagccagcaacatccgcaacgactggcgggtggggctggacgtgtctcccaaacccagc
gccaacgtgcatgtgaccgtggctggctcgcactcccacatggccaacttcgcggcccag
aagaccttccacgaccagtacagcttcagcactgacttggtggaatgtcgcttctacagc
tctcacctggtacactctcccccactccaccccaatttccagagggtcgtcagagacctg
ccccccgacttcaacacctccaccgaggccgactacctccggctcatctccaactacggc
acccacttcatccggtccatggagctgggcggccggatctcggccctcaccgccctgcgc
acctgtgagctggccctggatgggctcggggccaaagaggtggaggactgcctggccgtc
gaggcccaggtcagcataagtggccgtgccgactcttcatcggaactcaaggcctgtgag
gagaagaagaagcaccacaagataaccacctccttccaccaggcctatcgggagcgcttt
tccgaaatagttggcggccaccacacctccgtaagtgacctgctgtttggggaccaggcc
gggcccgagcagttctcggcctgggtggcctcgctgctggacagacccagcctggtggac
tacaccctggagcctctgcatgtgctcctggagagccaggacccgcggcgggaggccctg
cgacaggccgtgagcaagtacgtgatggacagggcccgctggaaggactgtagcaggcct
tgccccctggggcagaagaagagcccccacaacccatgccagtgtgtctgccacggctca
gcggtcaccaaccaggactgctgtccccggcagaggggcctggcccacttggaggtcatg
aacttccaggcgtcaggcctgtggggagactctttcactaggacggacgcctacctgaag
gtcttctttggaggccaggagctgagagtgggcacagtgtggaacgataacaaccccaag
tggatgacgcggctggacttcggggacgtgatcctgtccaccgggggtcccctgagggtg
caggtctgggaccaagaccacggctgggacgatgacctcctcggcacctgtgaccagaac
ccacggtctggcttgcacgaggtgaggtgtggcctgtcccacggtcacctgagattctcc
taccatgccaagtgcttgcctcacctgaagggggccacctgcctggagtatgccccccac
ggtcttctgggggagcttcccggaaaccggagtgggccggtgtggtga

DBGET integrated database retrieval system