KEGG   Felis catus (domestic cat): 100113473Help
Entry
100113473         CDS       T02385                                 

Gene name
PRF1, perforin
Definition
(RefSeq) perforin 1
  KO
K07818  
perforin 1
Organism
fca  Felis catus (domestic cat)
Pathway
Apoptosis
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100113473 (PRF1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100113473 (PRF1)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    100113473 (PRF1)
   05330 Allograft rejection
    100113473 (PRF1)
   05332 Graft-versus-host disease
    100113473 (PRF1)
  Cardiovascular diseases
   05416 Viral myocarditis
    100113473 (PRF1)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100113473 (PRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
D2
AA seq 555 aa AA seqDB search
MGACVLLPGLLLLLLPRPAPAPCHTAARSECRRNRPFVPGSMLAGEGVDVTSLRRSGSFP
VDTESFLRPDGTCTLCHNVLKQGALQRLPLALTDWRAQGSGCQRQVVRAKASSTEAVARE
AASNIRNDWRVGLDVSPKPSANVHVTVAGSHSHMANFAAQKTFHDQYSFSTDLVECRFYS
SHLVHSPPLHPNFQRVVRDLPPDFNTSTEADYLRLISNYGTHFIRSMELGGRISALTALR
TCELALDGLGAKEVEDCLAVEAQVSISGRADSSSELKACEEKKKHHKITTSFHQAYRERF
SEIVGGHHTSVSDLLFGDQAGPEQFSAWVASLLDRPSLVDYTLEPLHVLLESQDPRREAL
RQAVSKYVMDRARWKDCSRPCPLGQKKSPHNPCQCVCHGSAVTNQDCCPRQRGLAHLEVM
NFQASGLWGDSFTRTDAYLKVFFGGQELRVGTVWNDNNPKWMTRLDFGDVILSTGGPLRV
QVWDQDHGWDDDLLGTCDQNPRSGLHEVRCGLSHGHLRFSYHAKCLPHLKGATCLEYAPH
GLLGELPGNRSGPVW
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcctgcgtgctcctcccaggcctcctcctcctgctgctgccccgccccgcccca
gccccctgccacacggccgcccgctccgagtgccgccgcaaccgtccgtttgtgcccggc
tcaatgctggctggggagggcgtggacgtgaccagtctcaggcgctcgggctccttcccg
gtggacacagagagcttcctgcggcccgacggcacctgcactctctgccacaacgtcctg
aaacagggcgcccttcagcgcctccctctggcactgactgactggcgcgcccagggctca
ggctgccagcgccaagtggtcagggccaaggccagttccaccgaggccgtggccagggaa
gcagccagcaacatccgcaacgactggcgggtggggctggacgtgtctcccaaacccagc
gccaacgtgcatgtgaccgtggctggctcgcactcccacatggccaacttcgcggcccag
aagaccttccacgaccagtacagcttcagcactgacttggtggaatgtcgcttctacagc
tctcacctggtacactctcccccactccaccccaatttccagagggtcgtcagagacctg
ccccccgacttcaacacctccaccgaggccgactacctccggctcatctccaactacggc
acccacttcatccggtccatggagctgggcggccggatctcggccctcaccgccctgcgc
acctgtgagctggccctggatgggctcggggccaaagaggtggaggactgcctggccgtc
gaggcccaggtcagcataagtggccgtgccgactcttcatcggaactcaaggcctgtgag
gagaagaagaagcaccacaagataaccacctccttccaccaggcctatcgggagcgcttt
tccgaaatagttggcggccaccacacctccgtaagtgacctgctgtttggggaccaggcc
gggcccgagcagttctcggcctgggtggcctcgctgctggacagacccagcctggtggac
tacaccctggagcctctgcatgtgctcctggagagccaggacccgcggcgggaggccctg
cgacaggccgtgagcaagtacgtgatggacagggcccgctggaaggactgtagcaggcct
tgccccctggggcagaagaagagcccccacaacccatgccagtgtgtctgccacggctca
gcggtcaccaaccaggactgctgtccccggcagaggggcctggcccacttggaggtcatg
aacttccaggcgtcaggcctgtggggagactctttcactaggacggacgcctacctgaag
gtcttctttggaggccaggagctgagagtgggcacagtgtggaacgataacaaccccaag
tggatgacgcggctggacttcggggacgtgatcctgtccaccgggggtcccctgagggtg
caggtctgggaccaagaccacggctgggacgatgacctcctcggcacctgtgaccagaac
ccacggtctggcttgcacgaggtgaggtgtggcctgtcccacggtcacctgagattctcc
taccatgccaagtgcttgcctcacctgaagggggccacctgcctggagtatgccccccac
ggtcttctgggggagcttcccggaaaccggagtgggccggtgtggtga

DBGET integrated database retrieval system