KEGG   Felis catus (domestic cat): 100113473Help
Entry
100113473         CDS       T02385                                 

Gene name
PRF1, perforin
Definition
perforin 1 (pore forming protein)
Orthology
K07818  
perforin 1
Organism
fca  Felis catus (domestic cat)
Pathway
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Class
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:fca04650]
Human Diseases; Immune diseases; Autoimmune thyroid disease [PATH:fca05320]
Human Diseases; Immune diseases; Allograft rejection [PATH:fca05330]
Human Diseases; Immune diseases; Graft-versus-host disease [PATH:fca05332]
Human Diseases; Cardiovascular diseases; Viral myocarditis [PATH:fca05416]
Human Diseases; Endocrine and metabolic diseases; Type I diabetes mellitus [PATH:fca04940]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
D2
AA seq 555 aa AA seqDB search
MGACVLLPGLLLLLLPRPAPAPCHTAARSECRRNRPFVPGSMLAGEGVDVTSLRRSGSFP
VDTESFLRPDGTCTLCHNVLKQGALQRLPLALTDWRAQGSGCQRQVVRAKASSTEAVARE
AASNIRNDWRVGLDVSPKPSANVHVTVAGSHSHMANFAAQKTFHDQYSFSTDLVECRFYS
SHLVHSPPLHPNFQRVVRDLPPDFNTSTEADYLRLISNYGTHFIRSMELGGRISALTALR
TCELALDGLGAKEVEDCLAVEAQVSISGRADSSSELKACEEKKKHHKITTSFHQAYRERF
SEIVGGHHTSVSDLLFGDQAGPEQFSAWVASLLDRPSLVDYTLEPLHVLLESQDPRREAL
RQAVSKYVMDRARWKDCSRPCPLGQKKSPHNPCQCVCHGSAVTNQDCCPRQRGLAHLEVM
NFQASGLWGDSFTRTDAYLKVFFGGQELRVGTVWNDNNPKWMTRLDFGDVILSTGGPLRV
QVWDQDHGWDDDLLGTCDQNPRSGLHEVRCGLSHGHLRFSYHAKCLPHLKGATCLEYAPH
GLLGELPGNRSGPVW
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcctgcgtgctcctcccaggcctcctcctcctgctgctgccccgccccgcccca
gccccctgccacacggccgcccgctccgagtgccgccgcaaccgtccgtttgtgcccggc
tcaatgctggctggggagggcgtggacgtgaccagtctcaggcgctcgggctccttcccg
gtggacacagagagcttcctgcggcccgacggcacctgcactctctgccacaacgtcctg
aaacagggcgcccttcagcgcctccctctggcactgactgactggcgcgcccagggctca
ggctgccagcgccaagtggtcagggccaaggccagttccaccgaggccgtggccagggaa
gcagccagcaacatccgcaacgactggcgggtggggctggacgtgtctcccaaacccagc
gccaacgtgcatgtgaccgtggctggctcgcactcccacatggccaacttcgcggcccag
aagaccttccacgaccagtacagcttcagcactgacttggtggaatgtcgcttctacagc
tctcacctggtacactctcccccactccaccccaatttccagagggtcgtcagagacctg
ccccccgacttcaacacctccaccgaggccgactacctccggctcatctccaactacggc
acccacttcatccggtccatggagctgggcggccggatctcggccctcaccgccctgcgc
acctgtgagctggccctggatgggctcggggccaaagaggtggaggactgcctggccgtc
gaggcccaggtcagcataagtggccgtgccgactcttcatcggaactcaaggcctgtgag
gagaagaagaagcaccacaagataaccacctccttccaccaggcctatcgggagcgcttt
tccgaaatagttggcggccaccacacctccgtaagtgacctgctgtttggggaccaggcc
gggcccgagcagttctcggcctgggtggcctcgctgctggacagacccagcctggtggac
tacaccctggagcctctgcatgtgctcctggagagccaggacccgcggcgggaggccctg
cgacaggccgtgagcaagtacgtgatggacagggcccgctggaaggactgtagcaggcct
tgccccctggggcagaagaagagcccccacaacccatgccagtgtgtctgccacggctca
gcggtcaccaaccaggactgctgtccccggcagaggggcctggcccacttggaggtcatg
aacttccaggcgtcaggcctgtggggagactctttcactaggacggacgcctacctgaag
gtcttctttggaggccaggagctgagagtgggcacagtgtggaacgataacaaccccaag
tggatgacgcggctggacttcggggacgtgatcctgtccaccgggggtcccctgagggtg
caggtctgggaccaagaccacggctgggacgatgacctcctcggcacctgtgaccagaac
ccacggtctggcttgcacgaggtgaggtgtggcctgtcccacggtcacctgagattctcc
taccatgccaagtgcttgcctcacctgaagggggccacctgcctggagtatgccccccac
ggtcttctgggggagcttcccggaaaccggagtgggccggtgtggtga

DBGET integrated database retrieval system