KEGG   Felis catus (domestic cat): 100127108Help
Entry
100127108         CDS       T02385                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor isoform X1
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04072  Phospholipase D signaling pathway
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04520  Adherens junction
fca04910  Insulin signaling pathway
fca04913  Ovarian steroidogenesis
fca04923  Regulation of lipolysis in adipocytes
fca04930  Type II diabetes mellitus
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04960  Aldosterone-regulated sodium reabsorption
Module
fca_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100127108 (INSR)
   04015 Rap1 signaling pathway
    100127108 (INSR)
   04010 MAPK signaling pathway
    100127108 (INSR)
   04066 HIF-1 signaling pathway
    100127108 (INSR)
   04068 FoxO signaling pathway
    100127108 (INSR)
   04072 Phospholipase D signaling pathway
    100127108 (INSR)
   04022 cGMP - PKG signaling pathway
    100127108 (INSR)
   04151 PI3K-Akt signaling pathway
    100127108 (INSR)
   04152 AMPK signaling pathway
    100127108 (INSR)
   04150 mTOR signaling pathway
    100127108 (INSR)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    100127108 (INSR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100127108 (INSR)
   04923 Regulation of lipolysis in adipocyte
    100127108 (INSR)
   04913 Ovarian Steroidogenesis
    100127108 (INSR)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100127108 (INSR)
  Aging
   04211 Longevity regulating pathway - mammal
    100127108 (INSR)
   04213 Longevity regulating pathway - multiple species
    100127108 (INSR)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100127108 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100127108 (INSR)
   04931 Insulin resistance
    100127108 (INSR)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100127108 (INSR)
Protein kinases [BR:fca01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   100127108 (INSR)
CD molecules [BR:fca04090]
 Proteins
  100127108 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 100127108
NCBI-ProteinID: XP_023100560
Ensembl: ENSFCAG00000003030
Position
A2
AA seq 1381 aa AA seqDB search
MGAGAGRGAATAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELANCSVIEGHL
QILLMFKTRPEDFRDLSFPKLVMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VVFEMVHLKELGLYSLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTAKGKTNCPATVINGQFVERCWTHGHCQKVCPTVCKSHGCTADGLCCHSECL
GNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCRDLHNKCKNSRRQG
CHQYVIHNNRCIPECPSGYTMNSSNLMCTPCLGPCPKVCHILEGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSYIRTSYDKILLKWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWE
RQAEDSELYELDYCLKGLKLPSRTWSPPFESEGSQKRNQSEYEESAGECCSCPKTDSQIL
KELEESSFRKTFEDYLHNVVFVPRKSFSSPGAEDSRPSRKRRALADAGNVTAAVPTVPGF
PNTSSSVPTSPEEHKPFEKVVNKESLVISGLRHFTGYRIELQACNQDAPEERCSVAAYVS
ARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVS
RRHFALERGCRLRGLPPGNYSVRVRATSLAGNGSWTEATYFYVTDYLDVPSNIAKIIIGP
LIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVPRE
KITLLRELGQGSFGMVYEGNARDIVKGEAETRVAVKTVNESASLRERIEFLNEASVMKGF
TCHHVVRLLGVVSKGQPTLVVMELMVHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAA
EIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVR
WMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNC
PERVTDLMHMCWQFNPKMRPTFLEIVDLLKDDLHPSFPEVSFFHSEENKAPESEELEMEF
EDMESVPLDRASHSQREEAGGRDGVSSLGLKRNYEDHIPYTHMNGGKKNGRILTLPRSNP
S
NT seq 4146 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccggggctgggcggggggcggccaccgcgccgctgctggtggcggtggccgcg
ctgctgctgggcgccgcgggccacctgtaccccggagaggtctgccctggcatggatatc
cggaacaacctgacgaggctgcacgaactggccaactgctcggtcattgaaggtcatttg
cagatactgctcatgttcaaaacgaggcccgaggacttccgagacctcagtttccccaaa
ctcgtcatgatcactgattacctgctgctcttccgggtgtacgggctggagagcctgaag
gacctcttccccaacctcacggtcatccggggctcgcgcctcttcttcaactacgcgctg
gtcgtcttcgagatggtgcacttgaaggagcttggcctctacagcttgatgaacattacc
cggggctccgtccgcatcgagaagaataatgagctgtgctacctggccaccatcgactgg
tcgcgcatcctggattcggtggaggataattacattgtgttgaacaaagacgacaacgag
gagtgtggggacatttgtccaggcactgcaaagggcaagaccaactgccctgccactgtc
atcaacgggcagtttgtggagcgttgttggacacacggccattgccagaaagtttgtccg
accgtctgcaagtcgcacggctgcacggccgacggcctctgctgccacagcgagtgtttg
ggcaactgctccgagcccgacgaccccaccaagtgcgtggcctgtcgcaacttctacctg
gacggcaggtgcgtggagacctgcccgcccccctactaccacttccaagactggcgctgc
gtgaacttcagcttctgccgggacctgcacaataaatgcaagaactcccggagacagggt
tgccaccagtatgtcattcacaacaacaggtgcatccctgagtgcccctcggggtacacg
atgaattccagcaacctgatgtgtactccctgcctgggcccctgtcccaaggtctgccac
atcctggaaggcgagaagaccatcgactcggtgacatctgcccaggagctccgaggctgc
accgtcatcaacggaagcctaatcatcaacattcgagggggcaacaacctggcagctgag
ctggaggccaacctcggactcattgaagaaatttctgggtatctgaagatccgaagatcc
tatgctcttgtgtcactttcctttttccggaagttacggctgattcggggagagaccttg
gaaatcgggaactactctttctatgccttggacaaccagaacctgaggcagctatgggac
tggagcaaacacaacctcaccatcactcaggggaaactcttcttccactataatcccaaa
ctctgcttgtcggagattcacaagatggaggaggtttcaggaaccaaggggcgccaggag
cggaacgacattgccctgaagaccaatggggaccaggcgtcttgtgaaaatgaactactt
aaattttcttacattcggacgtcttacgacaagatcttgctgaaatgggaaccgtactgg
ccccctgacttccgagacctcctgggcttcatgctcttctacaaagaggccccttaccag
aatgtgaccgagttcgacgggcaggacgcgtgtggctccaacagctggacggtggtggac
attgacccgcctctgaggtccaatgaccccaagtcgcagaaccacccagggtggctgatg
cggggtctcaagccctggacccagtatgccatctttgtcaagaccttggtcaccttttct
gatgagcgccgcacgtatggggccaagagtgacatcatctatgtccagaccgatgccacc
aacccttccgtccccctggatcctatctcggtttcgaattcctcctctcagatcattctg
aagtggaagcctccctcggaccccaatggcaacatcacgcactacctggtgttctgggag
aggcaggcggaggacagcgagctgtatgagttggattattgcctcaaagggttgaagctg
ccttcccggacctggtccccgccgtttgagtccgagggctcccagaagcgcaatcagagt
gagtacgaggagtccgctggcgaatgctgctcgtgtcccaaaaccgactctcagatcctg
aaggagctggaggagtcctctttcaggaagacgttcgaggattacctgcacaatgtggtt
ttcgtgcccagaaaatccttttcaagccctggtgctgaggacagtaggccgtcgcggaag
cgcagggccctcgccgacgctgggaacgtgacggccgccgtgcccacggtgcctggtttc
cccaacacttccagcagcgtgcccacgagcccggaagagcacaagcccttcgagaaggtg
gtgaacaaagagtcgctggtcatctccggcctgcgtcacttcaccggctaccgcatcgag
ctgcaggcttgcaaccaagatgcccccgaggagaggtgcagcgtggccgcctacgtcagc
gccaggaccatgcccgaagccaaggcagacgacattgttggccctgtgacccatgaaatc
ttcgagaacaacgtggttcacttgatgtggcaagagcctaaagaacccaatggattgatc
gtgctgtatgaagtgagttaccgacggtatggtgatgaggagctgcacctctgtgtctcc
cgtagacactttgctctggagcggggctgcaggctgcgagggctgccgccggggaattac
agtgtgcgagttcgggccacctccctggcgggcaacggctcctggacagaagccacttat
ttctatgtgacagactatttagatgtcccatcgaacattgcaaaaattatcatcgggcct
ctcatctttgtctttctcttcagtgttgtgattggaagtatttatctattcctgagaaag
aggcagccggatgggccgctggggccgctgtatgcttcttcaaaccctgagtacctcagt
gccagtgatgtgtttccctgctctgtgtatgtgccggacgagtgggaggtgcctcgggag
aagatcactctcctgcgcgagctggggcagggctccttcggcatggtatacgagggcaat
gccagggacatcgtcaagggcgaggcggagacccgcgtggcggtgaagacggtcaacgag
tccgccagtctgcgagagaggatcgagtttctcaacgaggcctcagtcatgaagggcttc
acctgtcatcacgtggtccgcctcctgggggtggtgtccaaaggccagccgacgctggtg
gtgatggagctgatggttcacggagacctcaagagctacctccgctccctgcggccggag
gctgagaataaccctggccgccctccccctactctgcaagagatgattcagatggcggcg
gagatcgccgacgggatggcgtacctgaatgccaagaagtttgtgcaccgggatctcgca
gctcgaaattgcatggtggcccacgacttcaccgtcaaaattggagacttcggaatgacc
agagacatctatgaaacggattactaccggaaaggaggcaagggtctgctccccgtgcgg
tggatggcaccggaatccctgaaggacggggtcttcaccacttcttctgacatgtggtcc
tttggtgtggtcctttgggaaatcaccagcttggcggaacaaccttaccaaggcctgtct
aatgaacaggtgttgaaatttgtcatggacggaggatatttggaccaacctgacaactgt
ccggagagagtcaccgacctgatgcacatgtgctggcagttcaatcccaagatgcggccc
accttcctggagatcgttgacctgctcaaggacgacctgcaccccagctttccagaagtt
tccttcttccacagcgaggagaacaaggcgcctgagagtgaggagttggaaatggagttt
gaggacatggagagtgtccccctggatcgggcctcacactcacagagggaagaggccggg
ggccgggatggagtgtcctcgctgggcctcaagcggaactacgaggaccacatcccctac
acccacatgaacgggggcaagaaaaacggacggattctgaccctgccgaggtcgaatcct
tcctaa

DBGET integrated database retrieval system