KEGG   Felis catus (domestic cat): 100127109Help
Entry
100127109         CDS       T02385                                 

Gene name
LYZ
Definition
lysozyme
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
fca  Felis catus (domestic cat)
Pathway
Salivary secretion
Class
Organismal Systems; Digestive system; Salivary secretion [PATH:fca04970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B4
AA seq 148 aa AA seqDB search
MKALLFLGLLLLSVTVQGKIFQRCELAKTLKRLGMDGFKGVSLATWVCVAKWESDYNTRA
TNYNPGSRSTDYGIFQINSRYWCNDGKTPHAENACHVSCSELLQDNISQAVKCAKRVVSD
PQGIKAWVAWKKHCQNKDVSQYVRNCGV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctcctttttctggggcttctcctcctgtccgtcaccgtccagggcaagatc
tttcaaagatgtgagctggccaaaactctgaaaagacttgggatggatggctttaaaggt
gtcagcctggcgacctgggtgtgtgtggccaaatgggaaagtgattataacacaagggct
acaaactacaatcctggaagccgaagcactgattatgggatatttcagattaatagccgt
tactggtgtaatgatggcaaaaccccccatgcagaaaatgcctgtcatgtatcctgcagc
gagttgctgcaagataacatcagtcaagctgtaaaatgtgcaaagagggttgtcagtgat
ccacaaggcattaaagcatgggtggcgtggaaaaaacactgtcaaaacaaagatgtctct
cagtatgttcggaactgtggagtgtaa

DBGET integrated database retrieval system