KEGG   Felis catus (domestic cat): 100500740Help
Entry
100500740         CDS       T02385                                 

Gene name
UROS
Definition
uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fca  Felis catus (domestic cat)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:fca00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D2
AA seq 264 aa AA seqDB search
MKVLLLKDPKEDDCGQDPYIRELGLYGLEATLIPVLSFEFLSLSSFSEKLSHPEGYGGLI
FTSPRAVEAVELCLEKDNKTEVWKHSLKEKWNAKSVYVVGSATSSLVNKIGLDTEGESCG
NAEKLAEYICSRESPALPLLFPCGTVKGEILPKMLKDKGIPMESIIVYQKVPHPGIQVNL
HSYYSQQGIPASITFFSPSGLTHSLKHIQELSGDNIGRIKFAAIGPSTARALAAQGLPVS
CTAESPTPPALAKGLRLALQAPGC
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttcttttactaaaagaccctaaggaggatgactgtggccaagatccatatatc
agggaactaggattatatggacttgaagccactctgatccctgttttatcatttgagttt
ttgtctctttccagtttttctgagaagctgtctcatcctgaaggctacgggggcctcatt
tttaccagccccagagcagtggaagcagtggaactgtgtttggagaaagacaataaaact
gaagtctggaaacactctctgaaagaaaagtggaatgctaagtcagtatacgtggttgga
agtgctacctcttctctagtgaataaaatcggcctggacacagaaggagagagctgtgga
aatgcagaaaagctcgcagaatacatttgttccagggagtcaccggcattgcctctcctg
tttccctgtggaaccgtcaaaggggaaatcctgccgaagatgctcaaggacaaagggatt
cccatggaaagcatcatcgtctatcagaaggtcccacacccgggaatccaggtgaacctc
cacagctactattctcagcagggcatcccagcgagcatcacgtttttcagcccctctggc
ctcacccacagcctcaagcatattcaagagttatctggtgacaacattggtcgaatcaag
ttcgccgccatcggccccagcaccgcccgtgcgctggccgcccagggcctgcctgtgagc
tgcacggccgagagccccacgccaccagccctggccaagggcctcaggttggcgcttcag
gcccccggctgctga

DBGET integrated database retrieval system