KEGG   Felis catus (domestic cat): 101080395Help
Entry
101080395         CDS       T02385                                 

Gene name
GLS
Definition
(RefSeq) glutaminase
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
fca  Felis catus (domestic cat)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101080395 (GLS)
   00220 Arginine biosynthesis
    101080395 (GLS)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    101080395 (GLS)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    101080395 (GLS)
  Nervous system
   04724 Glutamatergic synapse
    101080395 (GLS)
   04727 GABAergic synapse
    101080395 (GLS)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    101080395 (GLS)
   05206 MicroRNAs in cancer
    101080395 (GLS)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     101080395 (GLS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
C1
AA seq 558 aa AA seqDB search
MMRLRGSAMLRDLRKARSKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTS
DPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHI
DELFESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPL
KYAIAVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNN
AEKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGIL
DFYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQ
FAFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYD
NLRHFAKKLDPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALH
VAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGD
SDNGKENQTVHKNLDGLL
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgactgcgaggctcggcgatgctgcgggacctgagaaaagctaggagtaaaata
aaacagggtctgttacctagcttggaagatttgctgttctatacaattgcagaaggacaa
gagaaaatacctgttcataaatttattacagcactcaaatctacaggattgcgaacgtct
gatcccaggttgaaagagtgtatggatatgttaagattaactcttcaaacaacatcagat
ggtgtcatgctagacaaagatctttttaaaaaatgtgttcaaagcaacattgttttgttg
acacaagcctttagaagaaagtttgtcattcctgactttatgtcttttacctctcacatt
gatgagttatttgaaagtgctaaaaagcagtctggaggaaaggttgcggattatattcct
cagctagccaagttcagtcctgatttgtggggtgtatctgtgtgtacagtagatggacag
aggcattctattggagataccaaagttccattttgtcttcagtcctgtgtaaaacctttg
aaatatgcaattgctgttaatgaccttggaacagaatatgtgcatcgatatgttgggaaa
gagccaagtggattaagattcaacaaactgtttttaaatgaagatgataagccacacaat
cctatggtaaatgctggagcaattgttgtgacttcattaataaagcaaggagtgaataat
gctgaaaaatttgactatgtgatgcagtttttgaataagatggctggcaatgaatacgtt
ggattcagtaatgcaacgtttcagtctgaaagagaaagtggagatcgaaattttgcaata
ggatattacctaaaagaaaaaaagtgttttccagaaggcacagacatggttggtatatta
gacttctatttccagctatgctccattgaagtaacttgtgaatcagccagtgtgatggct
gcaacactggctaatggtggtttctgtccaattactggtgagagagtactgagccctgaa
gcagttcgaaatacactgagtttgatgcattcctgtggcatgtatgatttctccgggcag
tttgctttccatgttggtcttcctgcaaaatctggagttgctgggggcattcttttagtt
gtccctaatgtcatgggcatgatgtgctggtctcctcctctggacaagatgggcaacagt
gttaagggaattcacttctgtcatgatcttgtttctctctgtaatttccataactatgat
aatttgagacactttgcaaaaaaacttgatcctcgaagagaaggtggtgatcaaagggtg
aagtcagtgataaaccttttgtttgctgcgtatactggagatgtatctgcacttcgaaga
tttgctctatcagccatggacatggaacagcgagactatgactctagaacagcactgcat
gtagctgctgcagagggtcatgttgaagttgttaaatttttgctggaggcatgcaaagta
aatcctttccccaaggacaggtggaataacactcccatggatgaagcgctgcacttcgga
caccacgatgtatttaagatcctccaggaataccaagtgcagtacacgcctcaaggagat
tccgacaacggaaaagaaaatcaaacggtccataagaatttggatggattgttataa

DBGET integrated database retrieval system