KEGG   Felis catus (domestic cat): 101080463Help
Entry
101080463         CDS       T02385                                 

Gene name
PTPRR
Definition
protein tyrosine phosphatase, receptor type, R
Orthology
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
fca  Felis catus (domestic cat)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101080463 (PTPRR)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     101080463 (PTPRR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
B4
AA seq 616 aa AA seqDB search
MLPAYYGFYGNVLAILFQTEVPPIKAHPAKRCSRIIPDHLNSLLNYYFNDYGILLEMTLQ
MDVNRLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNSVELFVSPINRKAGISDALPS
EEVLRSLNINVLHQSLSQFGIIEVSPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFVIIV
TCLMVIYNIKEKFQFSLRQDKEKNQEIHLSPIALQPAQSEAKTVNSMVQPEQAPKVLNVV
VDPQGRYTPEIKATTAVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNVEPFVAIPTPRE
KVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRYKTI
LPNPLSRVCLRPKNVTDSLSTYINANYIRGYSGKEKAFIATQGPMINTVNDFWQMVWQED
SPVIVMITKLKEKMRVKKNIQEGPGKLEREASSASIYQKCVLYWPEKRGIYGKVEVLVIN
VNECDNYTVRNLVLKQGGHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLAATGR
GPVVVHCSAGIGRTGCFIATSIGCRQLKEEGVVDALSIVCQLRVDRGGMVQTSEQYEFVH
HALCLYESRLSAETVQ
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgctgcctgcctattatggattctatggaaatgttcttgccatccttttccaaactgaa
gttccacccatcaaggctcatccagccaagagatgtagtagaatcatccctgatcacctt
aactctcttttgaactattattttaatgattatggtattttgctggaaatgacgctgcaa
atggatgtaaacaggctgaacataaccttgcttcggatattccgccaaggagtggctgca
gctttaggactcttaccccagcaagtgcacatcaatcgcctcattggaaagaagaacagt
gttgaactatttgtgtctcctataaaccgaaaagcaggaatttcggatgctctcccatct
gaggaagtgctgcgttcacttaatataaatgtcttacatcaaagtttatctcaatttgga
attatagaagtctcccctgagaaaaatgttttacaagggcagcatgaagcggacaaaatc
tggagcaaagaaggattttatgctgttgtcatttttctcagcatctttgttattatagta
acgtgtttgatggtaatatacaatattaaagaaaagtttcagttttccttgcgacaagat
aaagagaaaaatcaggagatccacctatcacccattgcattacagccagcacagtctgag
gcaaagacagtcaacagcatggtccagcccgagcaagccccaaaggtgctgaatgtggtt
gtggaccctcaaggccgatacactcctgagatcaaagctaccaccgctgtctgcccttct
cctttcaaaatgaagcccataggacttcaggagagacgagggtccaacgtatctcttaca
ttggacatgagtagcttggggaatgttgaaccttttgtggctatcccaaccccacgggag
aaggtagcaatggagtatctgcagtcagccagccgaatcctcacaaggtcacagctgagg
gacgtcgtggcaagttcacatttactccaaagtgaattcatggaaattccaatgaacttt
gtggatcccaaagaaattgacattccacgtcatggaactaaaaatcgctataagaccatt
ttgccaaaccccctaagcagagtgtgtttaagaccaaaaaatgtaactgattctttgagc
acctacattaatgctaattatattcggggctacagtggcaaagagaaagctttcatcgcc
acacagggccccatgatcaacaccgtgaatgatttctggcagatggtttggcaggaagac
agtcccgtgattgttatgatcacaaaactcaaagaaaaaatgagagtcaagaaaaacatt
caagagggccccggcaagcttgagagagaagcaagcagcgcttccatttatcaaaaatgt
gtgttatactggccagaaaagagaggaatttatgggaaagttgaggttctggttatcaat
gtaaatgaatgtgataactacaccgttcgaaaccttgtcttaaagcaaggaggtcacacc
cagcatgtgaagcattactggtacacctcatggccggatcacaagactccagacagtgcc
cagccccttctacagctcatgctggatgtagaagaagacaggcttgctgccacgggccga
gggcccgtggtcgtccactgcagcgcagggataggtagaacggggtgttttattgccaca
tccattggctgtcgacagttgaaagaagaaggagttgtcgatgcactaagcattgtctgc
cagcttcgtgtagacaggggtggaatggtccaaactagtgagcagtatgaatttgtacat
catgctctgtgcctgtatgagagcagactttcagcagaaactgtccagtga

DBGET integrated database retrieval system