KEGG   Felis catus (domestic cat): 101080463Help
Entry
101080463         CDS       T02385                                 

Gene name
PTPRR
Definition
protein tyrosine phosphatase, receptor type, R
Orthology
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
fca  Felis catus (domestic cat)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:fca04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
B4
AA seq 663 aa AA seqDB search
MEGKSWCFSRNNDQVLAIQQKKSGKPVFTYHHSQDIEKSLDITPQKIYKHTYHSSSKAQI
NKRHQIVNSAFPRPAYDPSLNLLAMAGQDLEVENLPIPAANVIVVTLQMDVNRLNITLLR
IFRQGVAAALGLLPQQVHINRLIGKKNSVELFVSPINRKAGISDALPSEEVLRSLNINVL
HQSLSQFGIIEVSPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFVIIVTCLMVIYNIKEK
FQFSLRQDKEKNQEIHLSPIALQPAQSEAKTVNSMVQPEQAPKVLNVVVDPQGRYTPEIK
ATTAVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNVEPFVAIPTPREKVAMEYLQSASR
ILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRYKTILPNPLSRVCLRP
KNVTDSLSTYINANYIRGYSGKEKAFIATQGPMINTVNDFWQMVWQEDSPVIVMITKLKE
KMRSYAFDIDVKKQKCVLYWPEKRGIYGKVEVLVINVNECDNYTVRNLVLKQGGHTQHVK
HYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLAATGRGPVVVHCSAGIGRTGCFIATSIGC
RQLKEEGVVDALSIVCQLRVDRGGMVQTSEQYEFVHHALCLYESRLQQKLSSDSLKIYQT
INL
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggagggcaaaagctggtgcttttccagaaataatgatcaagtgttggcaattcagcag
aagaagagtggaaagccagtattcacttatcaccattcacaagacattgagaagagcctg
gatataactccacaaaagatatataagcatacctatcattcctcttctaaagctcaaata
aacaaacgccaccaaattgttaattcagcatttccgagacctgcgtatgacccatctctc
aatctgctggctatggctggtcaagatcttgaagtggaaaaccttcctatccctgcagca
aatgtaattgtggtgacgctgcaaatggatgtaaacaggctgaacataaccttgcttcgg
atattccgccaaggagtggctgcagctttaggactcttaccccagcaagtgcacatcaat
cgcctcattggaaagaagaacagtgttgaactatttgtgtctcctataaaccgaaaagca
ggaatttcggatgctctcccatctgaggaagtgctgcgttcacttaatataaatgtctta
catcaaagtttatctcaatttggaattatagaagtctcccctgagaaaaatgttttacaa
gggcagcatgaagcggacaaaatctggagcaaagaaggattttatgctgttgtcattttt
ctcagcatctttgttattatagtaacgtgtttgatggtaatatacaatattaaagaaaag
tttcagttttccttgcgacaagataaagagaaaaatcaggagatccacctatcacccatt
gcattacagccagcacagtctgaggcaaagacagtcaacagcatggtccagcccgagcaa
gccccaaaggtgctgaatgtggttgtggaccctcaaggccgatacactcctgagatcaaa
gctaccaccgctgtctgcccttctcctttcaaaatgaagcccataggacttcaggagaga
cgagggtccaacgtatctcttacattggacatgagtagcttggggaatgttgaacctttt
gtggctatcccaaccccacgggagaaggtagcaatggagtatctgcagtcagccagccga
atcctcacaaggtcacagctgagggacgtcgtggcaagttcacatttactccaaagtgaa
ttcatggaaattccaatgaactttgtggatcccaaagaaattgacattccacgtcatgga
actaaaaatcgctataagaccattttgccaaaccccctaagcagagtgtgtttaagacca
aaaaatgtaactgattctttgagcacctacattaatgctaattatattcggggctacagt
ggcaaagagaaagctttcatcgccacacagggccccatgatcaacaccgtgaatgatttc
tggcagatggtttggcaggaagacagtcccgtgattgttatgatcacaaaactcaaagaa
aaaatgaggtcctatgcctttgacatagatgtaaagaaacaaaaatgtgtgttatactgg
ccagaaaagagaggaatttatgggaaagttgaggttctggttatcaatgtaaatgaatgt
gataactacaccgttcgaaaccttgtcttaaagcaaggaggtcacacccagcatgtgaag
cattactggtacacctcatggccggatcacaagactccagacagtgcccagccccttcta
cagctcatgctggatgtagaagaagacaggcttgctgccacgggccgagggcccgtggtc
gtccactgcagcgcagggataggtagaacggggtgttttattgccacatccattggctgt
cgacagttgaaagaagaaggagttgtcgatgcactaagcattgtctgccagcttcgtgta
gacaggggtggaatggtccaaactagtgagcagtatgaatttgtacatcatgctctgtgc
ctgtatgagagcagacttcagcagaaactgtccagtgattctctgaagatttaccagacc
atcaatctctag

DBGET integrated database retrieval system