KEGG   Felis catus (domestic cat): 101080570Help
Entry
101080570         CDS       T02385                                 

Gene name
APOA4
Definition
(RefSeq) apolipoprotein A-IV
  KO
K08760  
apolipoprotein A-IV
Organism
fca  Felis catus (domestic cat)
Pathway
Fat digestion and absorption
Vitamin digestion and absorption
Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:fca00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    101080570 (APOA4)
   04979 Cholesterol metabolism
    101080570 (APOA4)
   04977 Vitamin digestion and absorption
    101080570 (APOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
D1
AA seq 382 aa AA seqDB search
MFLRAVVLTLALVAVTGARAEVSPDQVATVVWDYFSQLSNNAKEAVEHLQQSELTQQLNA
LFQDKLGQVNTYADNLQKKLVPFATELHERLTKDSEKLKEEIRKELEELRARLLPHANEV
SQKIGDNVRELQQRLGPYADELRTQVNTHAEHLRRHLTSHAQRMEAVLRENVDNLQSSLT
PYADEFKAKIDQNIEELKGHLTPYADELKVKIDQNVEELRRSLAPYAQDVQEKLNHQLEG
LAFQMKKNAEELKAKITANADELRQRLAPVAEDVRSKLRDNAKGLQESLAQLNSHLDRQV
EEFRRNLGPYGDTFNRALVQQVEELRQKLGPYAGGMEDHLSFLEKDLRDKVNSFFITLKE
KENQDRPLALPEQEQAPGPLES
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgagggctgtggtcctgaccctggccctagtggctgtcaccggtgcccgggct
gaggtcagtcccgaccaggtggccaccgtggtgtgggactacttcagtcagctgagcaac
aatgccaaggaagccgtggaacatctccagcagtctgagctcacccagcagctcaatgcc
ctcttccaggacaagcttgggcaagtgaacacctatgcggataacctgcagaagaagctc
gtgcccttcgccactgagctgcacgaacgcctgaccaaagactcggagaagctgaaggag
gagattcggaaggagctggaggagctgcgggcacggctgctgccccacgccaacgaggtg
agccagaaaatcggggacaatgtgcgcgagctgcagcagcgcctggggccgtacgcggat
gagctgcgcacccaggtcaacactcacgccgagcacctgcggcgccacctgacgtcccac
gcgcagcgcatggaggccgtgctgcgcgagaacgtggacaacctgcagtcctcactgacg
ccctatgcagatgagttcaaggccaagatcgaccagaacatagaagagctcaaggggcat
ctcacgccctacgccgatgagctcaaggtcaagatcgaccagaacgtggaagagctgcgt
cgcagcctggctccctacgcgcaggacgtccaggagaagctcaaccaccagctcgagggg
ctggccttccagatgaagaagaatgccgaggagctgaaggccaagatcacggccaatgcc
gacgagctgcggcagaggctggcgccggtggccgaggacgtgcgcagcaagctgagggac
aacgccaagggactgcaggagtcgctggcccagctcaacagccacctggaccggcaggtg
gaggagttccgccgcaacctggggccctacggcgacaccttcaacagagccctggtgcag
caggtggaggagctcaggcagaagctgggcccctacgcaggcgggatggaagaccacctg
agcttcctggagaaggatctgagagacaaggtcaactctttcttcatcaccctcaaggag
aaggagaaccaggacaggcctctggccctccccgagcaggagcaggcgccaggccctttg
gagagctga

DBGET integrated database retrieval system