KEGG   Felis catus (domestic cat): 101080570Help
Entry
101080570         CDS       T02385                                 

Gene name
APOA4
Definition
apolipoprotein A-IV
Orthology
K08760  
apolipoprotein A-IV
Organism
fca  Felis catus (domestic cat)
Pathway
Fat digestion and absorption
Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:fca00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    101080570 (APOA4)
   04977 Vitamin digestion and absorption
    101080570 (APOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
D1
AA seq 382 aa AA seqDB search
MFLRAVVLTLALVAVTGARAEVSPDQVATVVWDYFSQLSNNAKEAVEHLQQSELTQQLNA
LFQDKLGQVNTYADNLQKKLVPFATELHERLTKDSEKLKEEIRKELEELRARLLPHANEV
SQKIGDNVRELQQRLGPYADELRTQVNTHAEHLRRHLTSHAQRMEAVLRENVDNLQSSLT
PYADEFKAKIDQNIEELKGHLTPYADELKVKIDQNVEELRRSLAPYAQDVQEKLNHQLEG
LAFQMKKNAEELKAKITANADELRQRLAPVAEDVRSKLRDNAKGLQESLAQLNSHLDRQV
EEFRRNLGPYGDTFNRALVQQVEELRQKLGPYAGGMEDHLSFLEKDLRDKVNSFFITLKE
KENQDRPLALPEQEQAPGPLES
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgagggctgtggtcctgaccctggccctagtggctgtcaccggtgcccgggct
gaggtcagtcccgaccaggtggccaccgtggtgtgggactacttcagtcagctgagcaac
aatgccaaggaagccgtggaacatctccagcagtctgagctcacccagcagctcaatgcc
ctcttccaggacaagcttgggcaagtgaacacctatgcggataacctgcagaagaagctc
gtgcccttcgccactgagctgcacgaacgcctgaccaaagactcggagaagctgaaggag
gagattcggaaggagctggaggagctgcgggcacggctgctgccccacgccaacgaggtg
agccagaaaatcggggacaatgtgcgcgagctgcagcagcgcctggggccgtacgcggat
gagctgcgcacccaggtcaacactcacgccgagcacctgcggcgccacctgacgtcccac
gcgcagcgcatggaggccgtgctgcgcgagaacgtggacaacctgcagtcctcactgacg
ccctatgcagatgagttcaaggccaagatcgaccagaacatagaagagctcaaggggcat
ctcacgccctacgccgatgagctcaaggtcaagatcgaccagaacgtggaagagctgcgt
cgcagcctggctccctacgcgcaggacgtccaggagaagctcaaccaccagctcgagggg
ctggccttccagatgaagaagaatgccgaggagctgaaggccaagatcacggccaatgcc
gacgagctgcggcagaggctggcgccggtggccgaggacgtgcgcagcaagctgagggac
aacgccaagggactgcaggagtcgctggcccagctcaacagccacctggaccggcaggtg
gaggagttccgccgcaacctggggccctacggcgacaccttcaacagagccctggtgcag
caggtggaggagctcaggcagaagctgggcccctacgcaggcgggatggaagaccacctg
agcttcctggagaaggatctgagagacaaggtcaactctttcttcatcaccctcaaggag
aaggagaaccaggacaggcctctggccctccccgagcaggagcaggcgccaggccctttg
gagagctga

DBGET integrated database retrieval system