KEGG   Felis catus (domestic cat): 101080675Help
Entry
101080675         CDS       T02385                                 

Gene name
PLCG2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00562  Inositol phosphate metabolism
fca01100  Metabolic pathways
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04020  Calcium signaling pathway
fca04064  NF-kappa B signaling pathway
fca04066  HIF-1 signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04072  Phospholipase D signaling pathway
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04380  Osteoclast differentiation
fca04611  Platelet activation
fca04625  C-type lectin receptor signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04670  Leukocyte transendothelial migration
fca04722  Neurotrophin signaling pathway
fca04750  Inflammatory mediator regulation of TRP channels
fca04919  Thyroid hormone signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05167  Kaposi's sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05214  Glioma
fca05223  Non-small cell lung cancer
fca05225  Hepatocellular carcinoma
Module
fca_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101080675 (PLCG2)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    101080675 (PLCG2)
   04012 ErbB signaling pathway
    101080675 (PLCG2)
   04370 VEGF signaling pathway
    101080675 (PLCG2)
   04064 NF-kappa B signaling pathway
    101080675 (PLCG2)
   04066 HIF-1 signaling pathway
    101080675 (PLCG2)
   04020 Calcium signaling pathway
    101080675 (PLCG2)
   04070 Phosphatidylinositol signaling system
    101080675 (PLCG2)
   04072 Phospholipase D signaling pathway
    101080675 (PLCG2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    101080675 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    101080675 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    101080675 (PLCG2)
   04662 B cell receptor signaling pathway
    101080675 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    101080675 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    101080675 (PLCG2)
   04670 Leukocyte transendothelial migration
    101080675 (PLCG2)
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101080675 (PLCG2)
  Nervous system
   04722 Neurotrophin signaling pathway
    101080675 (PLCG2)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101080675 (PLCG2)
  Development
   04360 Axon guidance
    101080675 (PLCG2)
   04380 Osteoclast differentiation
    101080675 (PLCG2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101080675 (PLCG2)
   05206 MicroRNAs in cancer
    101080675 (PLCG2)
   05205 Proteoglycans in cancer
    101080675 (PLCG2)
   05225 Hepatocellular carcinoma
    101080675 (PLCG2)
   05214 Glioma
    101080675 (PLCG2)
   05223 Non-small cell lung cancer
    101080675 (PLCG2)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101080675 (PLCG2)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    101080675 (PLCG2)
   05169 Epstein-Barr virus infection
    101080675 (PLCG2)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    101080675 (PLCG2)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101080675 (PLCG2)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101080675 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101080675 (PLCG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH PH_12 SH3_2 GDPD
Motif
Other DBs
NCBI-GeneID: 101080675
NCBI-ProteinID: XP_019675679
Ensembl: ENSFCAG00000004987
UniProt: M3W393
Position
E2
AA seq 1265 aa AA seqDB search
MTAMVNMDTLPEYEKSQIKRTLELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAARQKEDCCFTILYGTQFVLSTLSLAADSKEDAT
KWLSGLKILHQEAMSASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLVNFKVNSA
KFLKDKFVEIGAHKDELSFEQFHVFYKNLMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VYLHDFQRFLLHEQQEVWAQDLNKVRERMTKFIDDTLRETAEPFLFVDEFLTYLFSRENS
IWDEKYDVVDIQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCCVEQQRHMARV
FKEVFGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNVEDKKDEHKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTAEEELPQDIPPTELHFGEEWFHKKVEKR
TNAEKLLQEYCAETGGKDGTFLVRESKTFPNDYTLSFWRSGRVQHCRIRSVMEGGTMKYF
LTDNIMFTSIYDLIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYDGLSRGEAEDML
MRVPRDGAFLIRRREGTDSYAITFRARGKVKHCRIHRDGRHFVLGTSAYFESLVELVSYY
EKHALYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKRSDELSFCRGALIHNVSKEPWGWWKGDYGTRIQQYFPSNYVEDISTVDVEELEKQII
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKAFVFILEPKKQGDPPVEFATDRVEELFEWF
QSIREITWKMDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
TKADSVVRQKPVDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTPDKY
MQMNQALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILMTLTVKVLGARHLPKLGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLSPVWAPTQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMQPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFNVNENQLQLYQEKCNRRLREKRVSN
SRFYS
NT seq 3798 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccatggtcaacatggacacccttcctgaatatgagaagagtcagatcaagaga
accctggagctgggcacggtgatgaccgtgttcagctttcgcaagtctaccccggagcgg
aggactgtccaggtgatcatggagacgcggcaggtggcctggagcaagacggctgacaag
attgaaggcttcttggatatcatggaaatcaaggaaatccgccccgggaagaactccaag
gattttgagcgcgcgaaggcagcccggcagaaggaggactgctgtttcaccatcttgtac
ggcacccagttcgtcctgagcactctcagtttggcagctgattctaaagaagacgcgact
aagtggctctctggcttgaaaatcttacaccaggaagcgatgagtgcgtctacgcccacc
attattgagagttggctgagaaagcagatttattcagtggatcaaaccagaagaaacagc
atcagcctccgagagctgaagaccatcttgcccctggtcaacttcaaagtgaacagtgcc
aagttcctcaaagataagtttgtggaaatcggcgctcacaaagatgaactcagctttgag
cagttccacgttttctataaaaatcttatgtttgagcagcaaaagtcgattcttgatgaa
ttcaaaaaagattcttccgtgttcatcttgggcaacaccgaccggccggatgcctccgct
gtttacctgcacgacttccagcggtttctcctacacgaacagcaggaggtttgggctcag
gatctgaacaaagtccgcgagcgaatgacaaagtttatcgatgacaccctgagggagacc
gccgagcccttcctgtttgttgatgagttcctcacgtacctgttttcgcgggagaatagc
atctgggatgagaagtatgacgtcgtggacatacaggacatgaacaaccccttgtcccat
tactggatctcctcctcacataacacgtacctcaccggtgaccagctgcggagcgagtcg
tccacggaggcatacatccgctgcctgcgcatgggctgtcgctgcatcgagctggactgc
tgggacgggcccgatgggaagcccatcatctaccacggctggacgcggaccaccaagatc
aagtttgatgacgtcgtgcaggccatcaaagaccatgcctttgtcacctcaagcttcccg
gtgatcctgtccatcgaagagcactgctgtgtggagcagcagcgccacatggccagggtg
ttcaaggaggtgtttggcgacctgctgttgacgaagcccacggaggccagtgctgaccag
ctgccctcgcccagccagctgcgggagaagatcatcatcaagcataagaagctgggcccc
cgaggcgacgtggatgtcaacgtggaagataagaaagatgagcacaagcaacagggtgaa
ctgtacatgtgggattccattgaccagaaatggacccggcactactgtgccatcgctgat
gccaagctgtcgttcagcgatgacattgagcagactgcagaggaggagctgccccaggat
ataccccccacggagctgcattttggggaggagtggttccacaagaaggtggagaagaga
acaaacgccgagaagctgctgcaggaatactgtgccgagacggggggcaaagatgggacc
ttcttggtgcgggagagcaagaccttccccaacgactacaccctgtccttctggcggtcc
ggccgggtccagcactgccggatccgctccgtcatggagggcgggaccatgaagtacttc
ctgactgacaacatcatgttcaccagcatctatgacctcatccagcactaccgtgagacg
cacctgcgctgtgccgagttcgagctccggctcaccgaccccgtgcccaaccccaacccc
cacgagtcaaagccgtggtactatgatggcctgagccgcggggaagcagaggacatgctg
atgagagttccccgggacggggccttcctgatccggaggcgggaaggtaccgactcctac
gccatcaccttcagggccaggggcaaagtaaagcattgccgcatccatcgggacggccgg
cactttgtgctggggacctctgcctacttcgagagcctcgtcgagctggtcagttactac
gagaagcacgcgctgtaccggaagatgcggctgcgctatcctgtgacgcctgagctgctg
gagcgctacaatatggaacgagatatcaactccctctatgacgtcagcaggatgtatgtg
gatcccagtgaaatcaacccgtccatgcctcagaggaccgtcaaagctctgtatgactac
aaagccaagcgaagcgatgagctgagcttctgccgtggggccctcattcacaacgtctcc
aaggagccctggggctggtggaaaggagactatgggaccaggatccagcaatacttccca
tccaactatgttgaggacatttcaacggtcgatgtggaagaactggaaaagcagattatt
gaagacaatcccttagggtctctttgcagaggaatactggatctcaacacctataacgtc
gtgaaagccccgcaggggaaaaaccagaaggcgttcgtgttcatcctggagcccaagaag
caaggcgaccctccggtggagtttgccacagacagggtcgaggagctctttgagtggttt
cagagcatccgggagatcacctggaagatggacaccaaggagaacaacatgaagtactgg
gagaagaaccagtccatcgccatcgagctctcggacctggtagtctactgcaagcccacc
agcaagaccaaggacaatttagaaaaccccgacttccgagaaatccgctccttcgtggag
acgaaggctgacagtgtcgtcagacagaaaccggtcgacctcctcaagtacaatcagaag
ggcctgacccgtgtttacccgaagggacagagggtggactcctccaactacgaccccttt
cgcctctggctatgtggctcccagatggtggcactcaatttccagactccagacaagtac
atgcagatgaatcaagccttgttctcactcaacgggcggacaggctacgtcctgcagccc
gagagcatgaggacggagaagtacgaccccatgccgcccgaatcccagcggaagattctg
atgactctgaccgtcaaggttctcggggctcgccatctccccaaacttggccgaagcatc
gcatgtccctttgtggaggtggaaatctgcggggctgaatatgacaacaacaagtttaag
accacagttgtgaatgacaatggcctaagccccgtttgggctccgacacaggagaaggtg
acctttgaaatttatgacccaaacctcgcgtttctgcgctttgtggtctacgaggaagat
atgttcagtgatcctaacttcctcgctcatgccacttaccccatcaaaggaatcaaatca
ggattcagatctgttcctctgaagaacgggtacagtgaagatatcgagctggcttccctc
ctggtgttctgtgagatgcagccagtcctggagagtgaagaggaactctactcctcctgc
cgccagctgcgaaggcggcaggaagagctgaacaaccagctgttcctgtacgacacacac
cagaatctgcgcaatgccaaccgggatgccctcgtcaaagagttcaacgtcaacgagaac
cagctccagctgtaccaggagaagtgcaaccggaggttaagagagaagagagttagcaac
agtaggttttactcatag

DBGET integrated database retrieval system