KEGG   Felis catus (domestic cat): 101080732Help
Entry
101080732         CDS       T02385                                 

Gene name
KAT2B
Definition
K(lysine) acetyltransferase 2B
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
fca  Felis catus (domestic cat)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101080732 (KAT2B)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101080732 (KAT2B)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101080732 (KAT2B)
  Infectious diseases
   05166 HTLV-I infection
    101080732 (KAT2B)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101080732 (KAT2B)
Transcription machinery [BR:fca03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101080732 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
C2
AA seq 746 aa AA seqDB search
MLFLVFSGVSQLQWKAEESCKCNGWKNPNPSPTPPRADLQQIIVSLTESCRSCSHALAAH
VSHLENVSEEEMNRLLGIVLDVEYLFTCVHREEDADTKQVYFYLFKLLRKSILQRGKPVV
EGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPAKERQTIVELAKMFLNRINYWHLEAPSQR
RLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQ
ARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVIS
PPPVAGTISYNSNSSSLEQPNGGSTSPSCKGSSGLEANPGEKRKMNDSHALEEAKKPRVM
GDIPMELIDEVMSTITDPAAMLGPETNLLSAHSARDEAARLEERRGVIEFHVVGNSLNQK
PNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQ
GFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHDILNFLTYADEYAIGYFKKQGFSKEI
KIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYP
GLSCFKDGVRQIPIESIPGIRETGWKPSGREKSKEPKDPDQLYSTLKSILQQVKSHQSAW
PFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPE
SEYYKCANILEKFFFSKIKEAGLIDK
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttttagtatttagtggagtttctcaactgcagtggaaggccgaggagtcttgt
aaatgtaatggctggaaaaaccccaacccttctcctactccccccagagctgatctgcag
caaataattgtcagtctaacagaatcctgccggagttgtagccatgccctagctgcccat
gtctcccacctggaaaacgtgtcagaggaagagatgaacagactcctgggaatagtgttg
gatgtggaatatctctttacctgcgtccacagggaagaagatgcagacaccaaacaagtt
tatttctatctatttaagctcttgagaaagtctattttacaaagaggaaaacctgtggtt
gaaggctctttggagaagaaacccccatttgaaaaacctagtattgaacagggtgtgaat
aactttgtgcagtacaagtttagtcacctgccagccaaagaaaggcaaacgatagttgag
ttggcaaaaatgttcctaaaccgcatcaactattggcatctggaggcaccgtctcaacga
agactgagatctcccaatgatgatatttctggatacaaagagaactacacaaggtggctg
tgttactgcaacgtgccccagttctgtgacagtctacctcggtatgaaaccacccaggtg
tttgggagaacactgctgcgctcagtcttcacagttatgagacgacaactcctggagcag
gcgaggcaggaaaaagacaaactgccacttgagaaacgaactctaatcctcacccacttc
ccaaagtttctatccatgttagaagaagaagtttatagtcaaaactctcctatctgggat
caggattttctctcagcctcttctagaaccagccagctaggaatccaaacagttatcagt
ccacctcctgtagctgggaccatttcatataattcaaactcatcttcccttgagcaacct
aatggagggagcaccagtccttcctgcaaaggctcttctgggcttgaggcaaacccagga
gaaaagaggaaaatgaatgactctcatgccttggaggaggccaagaaaccccgggttatg
ggggatattccaatggaattaattgacgaggtcatgtctaccatcacggaccctgcagca
atgcttggaccagagaccaatttactgtcagcacattcagccagggatgaggcagcgagg
ctggaggagcgcaggggtgtgattgaatttcacgtggtcggcaattccctgaaccagaaa
cccaacaagaagattctgatgtggctagtcggtctccagaatgtgttctcccaccagctg
ccccggatgcccaaagagtatatcacacggcttgtcttcgacccgaaacacaaaaccctt
gccctaattaaagatggccgtgtcatcggtggtatctgtttccgtatgttcccatcccaa
ggattcacagagattgttttctgtgctgtaacctcaaatgagcaagtcaagggctatgga
acacacctgatgaatcacttgaaagaatatcatataaagcatgacatcctgaactttctc
acatatgcagatgaatatgcaattggttatttcaagaaacagggtttctccaaagaaatt
aaaatacctaaaaccaaatatgttggctacatcaaggattatgaaggggccactttaatg
ggatgtgagctaaatccacggatcccatacacagaattttctgtcatcattaagaagcag
aaggagatcattaaaaagctgatagaaagaaaacaagcccagattcgaaaagtataccct
ggactttcgtgttttaaagatggagttcgacagattccaatagaaagcattcctggaatt
agagagacaggctggaagccgagtggaagagagaaaagtaaagagcccaaagaccctgac
cagctttacagcacgctcaagagcatcctccagcaggtgaagagccatcaaagcgcttgg
cccttcatggaacctgtgaagagaacagaagctccgggatattatgaagttataaggttc
cccatggatctgaaaaccatgagcgaacgcctcaagaataggtactacgtgtctaagaaa
ttattcatggcagatttacagcgagtctttaccaattgcaaagaatacaacccccctgaa
agcgaatactacaaatgtgccaatatcctggagaaattcttcttcagtaaaattaaggaa
gctggattaattgacaagtga

DBGET integrated database retrieval system