KEGG   Felis catus (domestic cat): 101080852Help
Entry
101080852         CDS       T02385                                 

Gene name
USP42
Definition
ubiquitin specific peptidase 42
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
fca  Felis catus (domestic cat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
E3
AA seq 1304 aa AA seqDB search
MTIVDKASESSDPPAYQNQPGSSEAASPGDMDAGSASWGAVSSLNDVSNHTLSLGPVPGA
VVYSSSSVPDKSKPSPQKDQALGDGIAPPQKVLFPSEKICLKWQQTHRVGAGLQNLGNTC
FANAALQCLTYTPPLANYMLSHEHSKTCHAEGFCMMCTMQAHITQALSNPGDVIKPMFVI
NEMRRIARHFRFGNQEDAHEFLQYTVDAMQKACLNGSNKLDRHTQATTLVCQIFGGYLRS
RVKCLNCKGVSDTFDPYLDITLEIKAAQSVNKALEQFVKPEQLDGENSYKCSKCKKMVPA
SKRFTIHRSSNVLTLSLKRFANFTGGKIAKDVKYPEYLDIRPYMSQPNGEPIIYVLYAVL
VHTGFNCHAGHYFCYIKASNGLWYQMNDSIVSTSDIRSVLSQQAYVLFYIRSHDVKNGGE
LTHSTHSPGQSSPRPVISQRVVGNKQAASGFMGPQLPSHVIKNPPHLNGTGPLKEAPSSS
MSSPSGNSSVSRAGSVNASTSVQNWSVNRPSVIPEHPKKQKITISIHNKLPVRQGQSQPS
LHGPSLDTPSKPVPSSTVTSSAMQSTSSASMTAVSSKVTKQMTPSESCSKPVMNGKSKLR
SSVLVPYGAESSEESDEEAKGLGKENGLGTIESSNSSVQDAEDDEASPLELREPVALNGA
DSPDSDLKENGLPCDGARCPVQPALHSENPFSKANGLPGKSMPAPLPPLPEDNILETFKL
GSKVKGATEETSSPGTEEGPAEGPGAELEPGSPSPDSREKPETLTSLSSKLKKASPPSDP
SIQSTKEEVSENIAAKPEEFSPGADDLCGSTRNGAGDDPLPKPCGPGDLTDDQSRPAQAA
SGTRTDSPRASAAVEAAQGSSPSPPARSEGACEHEPFCVSGDKRADTDTEGPWKGAGAAA
AAADLPSPQVDTGTERRSEGGPEQSHGEKREENKYRNRRDRSSSGERARESRSKTEDRYH
RKRRSYTRERPRQDRYRTEHCGGSQHHPCHGERASPGEPRSLARYGHHHPRSRGGSEQEW
GRYRHSEGEHPWAREKYYPEKLRWDKCRYYHDRYALYAAREWRPFHERPYDKAAAPGRPY
RDCYRSRKGCEAAAKGKGRHRFSPRAGPPPAPLPYPEKHPHEKLAPGAEDDPCDLAGRFH
DHENVKSRKRRYDSLENGDGRGEKRAWRGAQKEPLEEPKAKKHKKSKKKKKSKDKHRDRD
SRHQQDSDLSVACSDADLHRHKKKKKKKKRHSRKSEDFVKDSEPHLPKAASHETVDRFRR
TDGAFPLTDGPPLEGVGPFCEKRKHLRMGSRDDRCPLSECGQGD
NT seq 3915 nt NT seq  +upstreamnt  +downstreamnt
atgaccatagttgacaaagcttctgaatcctcagacccaccagcctatcagaatcagcct
ggcagctcggaggcggcctcaccgggagacatggatgcaggttctgccagctggggggcc
gtgtcttcgttaaatgatgtctcaaaccacacgctttctctaggaccagtacctggtgct
gtagtttattccagttcatctgtacctgataaatcaaagccgtcaccacagaaggatcaa
gccctaggtgatggcattgctcctccacaaaaagttcttttcccgtctgagaaaatttgt
cttaagtggcaacaaactcacagagttggagccgggctccagaatttgggcaacacctgt
tttgccaatgcagcattgcagtgtttgacttacacgccgcctcttgccaattacatgcta
tcacatgagcactccaagacatgtcacgcagaaggattttgtatgatgtgtaccatgcaa
gcacatatcacccaggcactcagtaatcctggggatgttattaagccgatgtttgtcatt
aatgagatgcggcgtatagctaggcacttccgctttggaaaccaagaagatgcccatgaa
ttccttcagtacactgttgatgctatgcaaaaagcatgcttgaatggcagcaataaatta
gacagacacacccaggctaccacactcgtttgtcagatatttggaggatacctaagatct
agagttaagtgtttaaattgcaaaggtgtctcagatacgttcgatccgtatctcgatata
acgttggagataaaggctgctcagagtgtgaacaaggcgctggagcagttcgtgaagccc
gagcagctcgacggggaaaactcgtacaagtgcagcaagtgtaaaaagatggttccagct
tctaagaggtttactatacacagatcctctaatgttcttacactttctctgaaacggttt
gcaaattttactggtggaaaaatcgctaaggatgtgaaataccctgagtaccttgacatc
cgaccgtacatgtctcaaccaaacggggaaccgattatttatgtcctgtatgcagtactg
gtccacactggctttaactgccatgctggccactacttctgctacatcaaagctagcaat
ggcctctggtatcaaatgaacgactccatcgtatccaccagtgatattagatcggtactc
agtcaacaagcttacgtactcttttatatcaggtcccacgatgtgaaaaatggaggtgaa
ctcacgcattccactcacagccccggccagtcctcgccccgacccgtaatcagccagcgg
gttgtcggcaacaaacaggccgcatcagggtttatgggaccacagcttccctctcatgtg
ataaagaacccacctcacttaaatgggaccggaccattgaaagaagcaccgagcagctcc
atgtcaagtcctagtggaaattccagtgtcagccgggccgggtctgttaatgcttcgact
tctgttcagaactggtccgttaacaggccctctgtgattccagagcatcccaagaaacaa
aaaatcacgatcagtattcacaacaagttacctgttcgccaaggccagtctcagcccagc
cttcacggcccttctctggacaccccgagcaagccggttccctcctccaccgtcaccagt
tctgcaatgcagtctacctcgagcgcatctatgacagcagtttctagcaaagtcacgaag
cagatgaccccgagtgagtcctgttctaagcctgtgatgaacggcaagtccaagctgcgc
tccagtgtcctggtgccctacggtgccgagtcgtccgaggagtctgacgaggaggcaaag
ggcctgggcaaggagaacggtctcggtacgatcgagagctcgaactcttccgtgcaggat
gctgaagacgacgaggcctctccgctcgagcttcgagagcctgtcgctctaaatggtgct
gacagtccagacagcgacctgaaagagaacggtctgccctgcgatggtgcccgctgccca
gtccagcctgccctacactcagaaaatcccttttctaaggcgaacggtcttcccggaaag
tcgatgcccgctcccctgccccctctcccggaagacaacatcttagagaccttcaaactc
ggcagcaaagtgaaaggcgccaccgaagagacaagttcacctggaaccgaggaaggtcct
gcagagggtcccggcgcagagctcgagcctggcagcccctctcctgattcccgggagaaa
ccggagacgctcacgagtcttagcagcaaattaaagaaggcctcgccaccctcggacccc
agcatccaatctaccaaagaagaagtctctgaaaacattgcagcaaaacccgaggagttt
tcgcccggtgccgacgatctctgcggcagcaccaggaacggcgcgggggacgatccgctc
cctaagccgtgcggccccggggatttaacagacgaccagagcagaccagcccaggctgca
tcagggacgcgcacagacagcccgcgggcctcggccgccgtggaggcggcgcagggttcg
agcccaagtcccccggctcgttccgagggcgcctgcgagcacgagcccttctgcgtcagc
ggagacaagcgcgcggacacggacacggagggcccttggaagggcgcgggcgcggccgcc
gccgccgccgacctcccctctccccaagtagacacgggtacagagcgtcgctcggaaggg
ggccccgagcagagtcacggtgaaaaacgtgaagaaaataagtatcgcaaccgaagagat
cgttcctccagcggagaacgcgcgagggagagccggagcaagaccgaggaccgctaccac
cgaaagcggcgctcgtacacgagggagcggcccaggcaggaccgctacaggacggagcac
tgcggcgggagccagcaccacccctgccacggcgagcgggccagccccggcgagccgcgc
tccctggccaggtacggccaccaccaccctcggagccggggcggctcggagcaggagtgg
ggccggtaccgccactcggagggcgagcacccctgggcccgggagaagtactaccccgag
aagctgcgctgggacaagtgccggtattaccacgacaggtacgccctgtacgcggcgcgg
gagtggaggcccttccacgagcgcccgtacgacaaggcggccgcgcccggccggccctac
cgggactgctacaggagcaggaagggctgcgaggcggccgctaaggggaagggtcggcac
cgcttcagcccccgcgccggcccgccccccgcgcccctcccctaccccgagaagcacccc
cacgagaagctcgcgcctggagccgaagacgacccctgtgacctcgccggccggtttcac
gaccacgagaacgtcaagtcgcggaaacggaggtacgacagcctggaaaacggcgacggt
cgcggagaaaagagagcctggagaggcgcacagaaggagcctttagaagagccgaaagcg
aagaagcacaaaaaatcaaagaagaaaaagaaatccaaagacaaacaccgagaccgagat
tccaggcatcagcaggattccgatctttcggtcgcgtgctctgatgccgacctccacaga
cacaaaaaaaagaagaagaaaaagaagaggcactcgaggaaatccgaggactttgtcaaa
gactcagagccacacctccccaaggccgccagccatgagactgttgaccgtttccggaga
acggacggcgctttccccctcactgacgggccgcctctggaaggcgttgggcctttctgt
gagaagagaaaacatttaaggatgggaagcagggatgacaggtgtcctctgtctgagtgt
ggccagggtgattga

DBGET integrated database retrieval system