KEGG   Felis catus (domestic cat): 101080903Help
Entry
101080903         CDS       T02385                                 

Gene name
USP1
Definition
ubiquitin specific peptidase 1
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
fca  Felis catus (domestic cat)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    101080903 (USP1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     101080903 (USP1)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101080903 (USP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
C1
AA seq 784 aa AA seqDB search
MPGVIPSESNGLSKGSPSKKNRLSLKFFQKKETKRALDFTDSQENEEKASEYRGSEIDQV
VPAAQSSPINCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKK
EALKDEANQKDKGNCKEDSLASYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRR
LLNTLRELNPMYEGYLQHDAQEVLQCILGNIQETCQLLKKEEVKNVVELSTKVEEKPHQK
EEMSGINTTEMDSMRHSEDYKEKLTKGNGKRKNDIEFGNIKKKIKASKEHQSLEENQRQT
RSKRKATGDTLEIPSKIIPKYVSENESSRPSQKKSRVKINWLKPATKQPSILSKFCSLGK
ITTNQGSKGQSKENEYDLEEDLGKCENESTTNGCELESPGNNVKSVNVNEVKPINKGAEQ
IGFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDELSKVEESSEISPEPKT
EMKTLRWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAASGL
EFDCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDSYGLFAVVMHSGITISSGHYTASVKV
TDLNSLELDKGNFVIDQMCEIGKPEPLNEEEARDVVENYDEEMSIRVSGNTQPSKVLNKK
NVEAIGLLGGQKSKADYELYNKASNPDKVANTAFAENRNSETNSTNGTHEVDTNKESSDQ
TGLNFSGFENKISYVVQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPSTSPTSTPYLLF
YKKL
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgcctggtgtcatacctagtgaaagtaatgggctttcaaaaggtagcccatccaaaaaa
aatagactttccttgaagttttttcagaaaaaggaaactaagagagccttggatttcaca
gattctcaagaaaatgaagaaaaggcttctgaatatagaggatctgaaattgatcaagtt
gttcctgcagcacagtcctcacctataaactgtgagaagagagaaaacttgttaccattt
gtgggactgaataatctcggcaatacttgttatcttaacagtatacttcaggtattatat
ttttgtcctggttttaaatctggggtgaagcacttatttaacattatttcaaggaagaaa
gaagccctgaaagatgaagccaatcaaaaagataagggaaattgtaaagaagattctttg
gcaagttatgaactcatatgcagtttacagtccttgatcatttcagttgaacagcttcag
gctagctttctcttaaatccagagaaatacactgatgaacttgctactcagccaaggcga
ctgcttaacacactcagggaactcaaccctatgtatgaaggatatctacagcatgatgca
caggaagtattacagtgtattttgggaaacattcaagaaacatgccaactcctaaaaaaa
gaagaagtaaaaaatgtggtagaattatctactaaggtagaagaaaaacctcatcagaag
gaggaaatgagtggtattaacaccacagagatggacagtatgaggcattctgaagactat
aaagaaaaactcacaaaaggaaatgggaaaagaaaaaatgacattgaatttggtaacata
aagaaaaaaattaaagcctctaaggaacaccagtcactggaagagaaccagagacaaacc
agatcaaaaaggaaagctacaggtgatacattagagattccttctaaaataatccccaag
tatgtttctgaaaatgaaagttcaagaccctcacaaaagaaatcaagagttaaaataaat
tggttaaagcctgcaactaagcaacccagcattctttctaaattctgtagtctggggaaa
ataacaacaaaccagggatccaaaggacagtcgaaagaaaatgaatatgatcttgaagag
gacttggggaagtgtgaaaatgaaagcacaactaatggttgtgaacttgaatctccaggg
aataatgttaagtccgttaatgttaatgaagttaaacccataaacaaaggtgcagagcaa
attggttttgagctagtagagaaattatttcaaggtcagctggtattaaggactcgttgc
ttagaatgtgaaagtttaacagaaagaagagaagattttcaggacatcagtgtgccagta
caagaagatgagctttccaaagtagaggagagttctgaaatttctccagagccaaaaaca
gaaatgaagaccctgagatgggcaatttcacagtttgcttcagtggagaggattgtagga
gaagataaatatttctgtgaaaattgccatcattatactgaagccgaacgaagtcttttg
tttgacaaaatgcctgaagttataactattcatttgaagtgctttgctgctagtggcttg
gagtttgattgctatggtggtggactttccaagatcaacactcctttactgacacctctt
aaactgtcactagaagaatggagcacaaagccaaccaacgacagctatgggttatttgca
gttgtgatgcacagtggcattaccatcagtagtgggcattacactgcttctgttaaagtc
actgaccttaacagtttagaactagataagggaaattttgtgattgaccaaatgtgtgaa
ataggtaaaccagaaccattgaatgaggaggaagcaagggatgtggttgaaaattatgat
gaagaaatgtcaattagagtcagtggaaatacacagccaagcaaagttctgaacaaaaaa
aatgtagaagctattggacttcttggaggacaaaagagcaaagcagattatgagctgtac
aacaaagcatctaatcctgataaagttgccaatacagcatttgctgaaaacagaaattct
gagactaacagtactaatgggactcatgaagttgatacaaacaaggaatccagtgaccaa
acaggccttaactttagtggatttgagaacaaaatttcatatgtagtgcaaagtttaaag
gagtatgagggaaagtggttactttttgatgattctgaagtgaaagttactgaagagaag
gactttctgaattctctttctccttctacatctcctacatctactccttacttgctattt
tataagaaattatag

DBGET integrated database retrieval system