KEGG   Felis catus (domestic cat): 101080903Help
Entry
101080903         CDS       T02385                                 

Gene name
USP1
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 1
  KO
K11832  ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Pathway
fca03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    101080903 (USP1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101080903 (USP1)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101080903 (USP1)
Ubiquitin system [BR:fca04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    101080903 (USP1)
DNA repair and recombination proteins [BR:fca03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     101080903 (USP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1
Motif
Other DBs
NCBI-GeneID: 101080903
NCBI-ProteinID: XP_011283258
UniProt: M3X7I7
Position
C1
AA seq 784 aa AA seqDB search
MPGVIPSESNGLSKGSPSKKNRLSLKFFQKKETKRALDFTDSQENEEKASEYRGSEIDQV
VPAAQSSPINCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKK
EALKDEANQKDKGNCKEDSLASYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRR
LLNTLRELNPMYEGYLQHDAQEVLQCILGNIQETCQLLKKEEVKNVVELSTKVEEKPHQK
EEMSGINTTEMDSMRHSEDYKEKLTKGNGKRKNDIEFGNIKKKIKASKEHQSLEENQRQT
RSKRKATGDTLEIPSKIIPKYVSENESSRPSQKKSRVKINWLKPATKQPSILSKFCSLGK
ITTNQGSKGQSKENEYDLEEDLGKCENESTTNGCELESPGNNVKSVNVNEVKPINKGAEQ
IGFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDELSKVEESSEISPEPKT
EMKTLRWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAASGL
EFDCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDSYGLFAVVMHSGITISSGHYTASVKV
TDLNSLELDKGNFVIDQMCEIGKPEPLNEEEARDVVENYDEEMSIRVSGNTQPSKVLNKK
NVEAIGLLGGQKSKADYELYNKASNPDKVANTAFAENRNSETNSTNGTHEVDTNKESSDQ
TGLNFSGFENKISYVVQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPSTSPTSTPYLLF
YKKL
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgcctggtgtcatacctagtgaaagtaatgggctttcaaaaggtagcccatccaaaaaa
aatagactttccttgaagttttttcagaaaaaggaaactaagagagccttggatttcaca
gattctcaagaaaatgaagaaaaggcttctgaatatagaggatctgaaattgatcaagtt
gttcctgcagcacagtcctcacctataaactgtgagaagagagaaaacttgttaccattt
gtgggactgaataatctcggcaatacttgttatcttaacagtatacttcaggtattatat
ttttgtcctggttttaaatctggggtgaagcacttatttaacattatttcaaggaagaaa
gaagccctgaaagatgaagccaatcaaaaagataagggaaattgtaaagaagattctttg
gcaagttatgaactcatatgcagtttacagtccttgatcatttcagttgaacagcttcag
gctagctttctcttaaatccagagaaatacactgatgaacttgctactcagccaaggcga
ctgcttaacacactcagggaactcaaccctatgtatgaaggatatctacagcatgatgca
caggaagtattacagtgtattttgggaaacattcaagaaacatgccaactcctaaaaaaa
gaagaagtaaaaaatgtggtagaattatctactaaggtagaagaaaaacctcatcagaag
gaggaaatgagtggtattaacaccacagagatggacagtatgaggcattctgaagactat
aaagaaaaactcacaaaaggaaatgggaaaagaaaaaatgacattgaatttggtaacata
aagaaaaaaattaaagcctctaaggaacaccagtcactggaagagaaccagagacaaacc
agatcaaaaaggaaagctacaggtgatacattagagattccttctaaaataatccccaag
tatgtttctgaaaatgaaagttcaagaccctcacaaaagaaatcaagagttaaaataaat
tggttaaagcctgcaactaagcaacccagcattctttctaaattctgtagtctggggaaa
ataacaacaaaccagggatccaaaggacagtcgaaagaaaatgaatatgatcttgaagag
gacttggggaagtgtgaaaatgaaagcacaactaatggttgtgaacttgaatctccaggg
aataatgttaagtccgttaatgttaatgaagttaaacccataaacaaaggtgcagagcaa
attggttttgagctagtagagaaattatttcaaggtcagctggtattaaggactcgttgc
ttagaatgtgaaagtttaacagaaagaagagaagattttcaggacatcagtgtgccagta
caagaagatgagctttccaaagtagaggagagttctgaaatttctccagagccaaaaaca
gaaatgaagaccctgagatgggcaatttcacagtttgcttcagtggagaggattgtagga
gaagataaatatttctgtgaaaattgccatcattatactgaagccgaacgaagtcttttg
tttgacaaaatgcctgaagttataactattcatttgaagtgctttgctgctagtggcttg
gagtttgattgctatggtggtggactttccaagatcaacactcctttactgacacctctt
aaactgtcactagaagaatggagcacaaagccaaccaacgacagctatgggttatttgca
gttgtgatgcacagtggcattaccatcagtagtgggcattacactgcttctgttaaagtc
actgaccttaacagtttagaactagataagggaaattttgtgattgaccaaatgtgtgaa
ataggtaaaccagaaccattgaatgaggaggaagcaagggatgtggttgaaaattatgat
gaagaaatgtcaattagagtcagtggaaatacacagccaagcaaagttctgaacaaaaaa
aatgtagaagctattggacttcttggaggacaaaagagcaaagcagattatgagctgtac
aacaaagcatctaatcctgataaagttgccaatacagcatttgctgaaaacagaaattct
gagactaacagtactaatgggactcatgaagttgatacaaacaaggaatccagtgaccaa
acaggccttaactttagtggatttgagaacaaaatttcatatgtagtgcaaagtttaaag
gagtatgagggaaagtggttactttttgatgattctgaagtgaaagttactgaagagaag
gactttctgaattctctttctccttctacatctcctacatctactccttacttgctattt
tataagaaattatag

DBGET integrated database retrieval system