KEGG   Felis catus (domestic cat): 101081210Help
Entry
101081210         CDS       T02385                                 

Gene name
FLNC
Definition
filamin C, gamma
Orthology
K04437  
filamin
Organism
fca  Felis catus (domestic cat)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101081210 (FLNC)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    101081210 (FLNC)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    101081210 (FLNC)
  Infectious diseases
   05132 Salmonella infection
    101081210 (FLNC)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101081210 (FLNC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
A2
AA seq 2693 aa AA seqDB search
MMNNSSYSEAAGLGLGDEVDDMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTD
LQRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDS
KAIVDGNLKLILGLIWTLILHYSISMPMWEDEEDEDARKQTPKQRLLGWIQNKVPQLPIT
NFNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEE
IVDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPHGNTVLQPAHFT
VQTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKNRTYAVSYVPKVAGLHKVTVLFAGQNI
ERSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQG
RRDTVEVALEDKGDSTFRCTYRPVMEGPHTVHVAFAGAPITRSPFPVHVAEACNPNACRA
SGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYHP
VVPGKYVVTITWGGYAIPRSPFEVQVSPEAGAQKVRAWGPGLKTGQVGKSADFVVEAIGT
EVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHIQ
PAAPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLNLYAQDADGCPVNIMVI
PNGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGL
KANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAG
RYTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGK
AKLDVHFAGAAKGEAVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVN
VAPPLDLSKVKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGG
GAETQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGT
PAPFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAH
IPGSPFKATIRPVFDPSKVRASGPGLERGKAGEAATFTVDCSEAGEAELTIEILSDAGVK
AEVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGVKVSGPG
VEPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAY
EEGVHLVEVLYDDVAVPKSPFRVGVTEGCDPTRVRAFGPGLESGLVNKANHFTVETRGAG
TGGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTAGDYDVNITFGGRPIPGSPFRVPVKD
VVDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDKGDG
THTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLP
VEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGD
EIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGEETVITVDAKAAGKGKVT
CTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLATEEPV
VPVEPMESMLRPFNLVIPFTVQKGELTGEVRMPSGKTARPNITDNKDGTITVRYAPTEKG
LHQMGIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGL
SLAVEGPSKAEITCKDNKDGTCTVSYLPTAPGDYSIIVRFDDKHIPGSPFTAKITGDDSM
RTSQLNVGTSTDVSLKITESDLSLLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGE
HVVSVRKSGKHVTNSPFKILVGPSEIGDASKVRVWGKGLSEGHTFQVAEFIVDTRNAGYG
GLGLSIEGPSKVDINCEDMEDGTCKVTYCPTEPGTYIINIKFADKHVPGSPFTVKVTGEG
RMKESITRRRQAPSIATIGSTCDLNLKIPGNWFQMVSAQERLTRTFTRSSHTYTRTERTE
ISKTRGGETKREVRVEESTQVGGDPFPAVFGDFLGRERLGSFGSITRQQEGEASSQDMTA
QVTSPSGKMEAAEIVEGEDSAYSVRFVPQEMGPHTVTVKYRGQHVPGSPFQFTVGPLGEG
GAHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEISFEDRKDGSCGVS
YVVQEPGDYEVSIKFNDEHIPDSPFVVPVASLSDDARRLTVTSLQETGLKVNQPASFAVQ
LNGARGVIDARVHTPSGAVEECYVSELDSDKHTIRFIPHENGVHSIDVKFNGAHIPGSPF
KIRVGEQSQAGDPGLVSAYGPGLEGGTTGVSSEFIVNTLNAGSGALSVTIDGPSKVQLDC
RECPEGHVVTYTPMAPGNYLIAIKYGGPQHIVGSPFKAKVTGPRLSGGHSLHETSTVLVE
TVTKSSSSRGSSYSSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGV
HGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYILIVKWGDESVPGSPFKVNVP
NT seq 8082 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacaacagcagctactcagaggccgccggcctcggcctgggcgacgaggtggac
gacatgccgtccacggagaaggacctggcggaggacgcgccgtggaagaagatccagcag
aacacgttcacgcgctggtgcaacgagcacctgaagtgtgtgggcaagcgcctgaccgac
ctgcagcgagacctcagcgacgggctgcgcctcatcgcgctgctcgaggtgctcagccag
aagcgcatgtatcgcaagttccacccgcgccccaacttccgccagatgaagctggagaac
gtgtccgtggccctcgagttcctggagcgcgagcacatcaagctcgtgtccatcgacagc
aaggccattgtggatgggaacctgaagctgatcctgggtctgatctggacgctgatccta
cactactccatctccatgcccatgtgggaggatgaggaggacgaggacgcccgcaagcag
acgcccaagcagcgtctgctcggctggatccagaacaaggtgccccagctgcccatcact
aacttcaaccgtgactggcaggatggcaaagctctgggcgccctggtggacaactgtgcc
cctggcctgtgccctgactgggaagcctgggaccccaaccagcctgtggagaacgcccgg
gaggccatgcagcaggcggacgactggctcggggtgccccaggtgattgcccccgaggag
attgtggaccccaacgtggatgagcattctgtcatgacctacctgtcccagttccccaag
gccaaactcaaacctggtgcccctgttcgctctaaacagctgaaccctaagaaggccatc
gcctacgggcctggcatcgagccccacggcaacactgtgctacagcctgcccacttcacc
gtgcagacggtggatgccggcgtgggcgaggtgctggtctacattgaggaccctgagggc
cacaccgaggaggccaaagtggttcccaacaatgacaagaaccgcacctatgctgtctcc
tatgtgcccaaggttgcggggttgcacaaggtgactgtgctctttgctggccagaatatc
gaacgcagtccctttgaggtgaacgtgggcatggctctgggagatgccaacaaggtgtca
gcccgtggccctggcctggagcctgtgggcaatgtggccaacaaacccacgtactttgac
atctatactgcgggggccggcactggtgatgttgccgtggtgatcgtggacccgcagggc
cggcgggacacagtggaggtggccctggaggacaagggcgacagcacgttccgatgcacg
tacaggcctgtgatggaggggccccacacggtgcatgtggccttcgctggtgcccccatc
acccgcagtcctttccccgtccatgtagctgaagcctgtaaccctaacgcctgccgtgcc
tctgggcggggcctgcagcccaagggtgtgcgtgtgaaagaggtggctgatttcaaggtg
ttcactaagggtgccggcagcggggagctcaaggtcacagtcaaagggccaaagggcaca
gaagagccagtgaaagtgcgagaggctggagatggcgtgttcgagtgtgagtaccaccct
gtggtgcctgggaagtatgtggtgaccatcacgtggggcggctacgccatcccccgcagt
ccttttgaggtacaggtgagcccagaggcaggagcgcagaaggtacgggcctggggtccc
ggcctgaaaactggccaggtggggaagtcggccgactttgtggtggaggccattggcacg
gaggtggggacactgggattctccattgaggggccctcacaggccaagatcgagtgtgat
gacaagggggatggctcctgcgatgtgcggtactggcccacggagcctggggagtacgcc
gtgcacgtcatctgcgatgatgaggacatccgagactcacccttcattgcccacatccag
ccagccgcacctgactgcttcccggataaggtgaaggcctttgggcctggcctggagccc
actggctgcatcgtggacaagcctgcagagttcaccatcgatgcccgtgctgctggcaag
ggagacctgaacctgtatgcccaggatgctgatggctgccctgtcaacatcatggtcatc
cccaatggcgacggcaccttccgctgctcctacgtgcccaccaagcccattaaacacacc
atcatcatctcctggggaggcgtcaatgtgcccaagagccccttccgggtgaacgtggga
gaaggcagtcaccccgagcgggtgaaggtatatggcccaggcgtggagaagacgggcctc
aaggccaacgagcctacctatttcaccgtggactgcagcgaggctgggcaaggtgacgtg
agtatcggcatcaagtgtgctcccggagtggtgggccctgcagaagctgacatcgacttt
gacatcatcaagaacgacaatgacaccttcacagtcaagtacacccccccaggggccggc
cgctacaccattatggtgctgtttgccaaccaggagatccctgccagccccttccacatt
aaggtggacccatcccacgatgccagcaaagtcaaggctgagggccctgggctgaaccgc
acgggtgtggaagtcgggaagcccactcacttcacggtgctgaccaagggagccggcaag
gccaagctggacgtgcactttgccggggctgccaagggtgaggccgtgcgggactttgaa
atcatcgacaaccatgactactcctacactgtcaagtacacagccgtccagcagggcaac
atggcagtgacggtgacctacggtggggaccctgtccccaagagcccctttgtggtgaat
gtggcacccccactggacctcagcaaagtcaaagttcaaggcctgaacagcaaggtggct
gtggggcaagaacaggccttctctgtgaacacacgtggggctggcggtcaagggcagctg
gatgtgcggatgacttcaccctcccgtcgccccatcccttgcaagctggagcctgggggc
ggagctgaaacccaggccgtgcgctacatgccccctgaggagggaccctacaaggtggac
atcacctacgacggtcacccagtgcccggtagcccctttgctgtggagggtgtcctgccc
cctgatccctccaaggtttgtgcgtatgggcccggtctcaagggcggcctggtaggcacc
ccggcaccgttctccattgacaccaagggggctggcacgggcggcctggggctgactgtg
gagggcccctgtgaggccaagattgagtgccaggacaacggtgacggctcatgtgctgtc
agctacctgcccacggagcccggcgagtacaccatcaacatcctgtttgccgaagcccac
atccctggctcacccttcaaggccaccatccggcccgtgttcgacccgagcaaggtgcgg
gccagtgggccgggcctggagcgtggcaaggctggcgaggcggccaccttcacggtggac
tgctcggaggctggcgaggctgagctgaccatcgagatcctgtcggacgccggtgtcaag
gccgaggtgctgatccacaacaatgccgacggcacctaccacatcacctacagccccgcc
tttcctggcacctacacaattaccatcaagtatggcgggcaccctgtccccaaattccct
acccgcgtccacgtgcagcctgctgtcgacaccagtggagtcaaggtctcagggcccggg
gtggagcctcacggtgtcctgcgtgaggtgaccactgagttcactgtggacgcaagatcc
ctaacagccacaggtgggaaccacgtgacagctcgtgtgctcaacccctcgggtgctaag
acggacacctatgtgacagacaacggggacggcacctaccgagtgcagtacacagcctat
gaagagggcgtgcatctggtggaggtcctgtatgatgacgtagctgtgcccaagagcccc
ttccgagtgggcgtgaccgagggctgtgaccccacccgcgtgagggcctttgggcctggc
ctggagagcggcttggtcaacaaggccaaccacttcactgtggagaccaggggagctggc
accggaggcctcggcctagccatcgagggcccctcagaagccaagatgtcctgcaaggac
aacaaagatggtagctgtaccgtggagtacatccctttcaccgctggagactacgacgtc
aacatcacctttggggggcggcccatcccagggagcccgttccgggtgccggtgaaggat
gtggtggaccctgggaaggtgaagtgctcagggccagggctgggggccggtgtcagggcc
cgggtaccccagaccttcacggtggactgcagccaagccggccgggccccactgcaagtg
gccgtgctgggccccacaggtgtagccgagcctgtagaggtgcgtgacaagggagatggc
acccacaccgtccactacaccccagccaccgatgggccctacacggtagccgtcaagtat
gccgaccaggaggtaccacgcagccctttcaagatcaaggtgcttcctgcccatgatgcc
agcaaggtgcgggccagcggccccggcctcaacgcctctggcatccctgccagcctgccc
gtggagttcaccatcgatgcccgggatgccggtgagggtttgctcaccgtccagatcctg
gacccggagggaaagcccaagaaagccaacatccgagacaacggggatggcacgtacact
gtgtcctacctgccagacatgagtggccggtacaccatcaccatcaagtatggcggcgac
gagatcccctactcgcccttccgcatccacgccctgcccactggggatgccagcaagtgt
cttgtcacagtgtccattggaggccatggcctgggtgcctgcttgggaccccgcatccag
atcggggaggagacagtgatcacggtggacgccaaggcggcaggcaaggggaaggtgacg
tgcacggtgtccactccggatggggcggagctcgacgtggatgtggttgagaaccacgac
ggtacctttgacatctactatacagcgcccgagccgggcaagtacgtcatcaccatccgc
tttggaggcgagcacatccccaacagccccttccacgtgctggccacagaggagccagtg
gtgcctgtagagccaatggagtccatgcttaggcccttcaacctggtcatccccttcacc
gtgcagaaaggagaactcacaggggaggtacggatgccctctgggaaaacagcccggccc
aacatcaccgacaataaggatggaaccatcacggtgaggtatgcacccaccgagaaaggc
ctgcaccagatggggatcaagtatgacggcaaccacatccctggaagccccctgcagttt
tatgtggatgccatcaatagccgccatgtgagtgcttatgggccaggcctgagccatggc
atggtcaacaagccggccaccttcaccattgtcaccaaggatgctggggaagggggcctg
tccctggctgtggagggcccatccaaggcagagatcacctgcaaggacaacaaggacggc
acctgcaccgtatcctacttacccacagcgcctggagactacagcatcatcgtgcgcttt
gatgacaagcacatcccaggaagccccttcacggccaagatcacaggcgatgactccatg
aggacatcacagctcaatgtgggcacctccacggatgtgtcactgaagatcacggagagt
gacctgagcctgctgactgccagcatccgcgccccctcaggcaacgaggagccctgccta
ttgaagcgcctgcccaacaggcacatcggcatctccttcaccccgaaggaggttggggag
cacgtggtaagcgtgcgcaaaagtggcaagcatgtcaccaacagccccttcaagatcctg
gtggggccatctgagatcggagatgccagcaaggtgcgggtctggggcaagggcctgtcc
gagggacacacgttccaggtggcggagttcatcgtggacactcgcaacgcaggttacggg
ggcctggggttgagtattgaaggccctagcaaggtggacatcaactgtgaggacatggaa
gatggcacatgcaaagtcacctactgccccaccgagcctggcacctacatcatcaacatc
aaatttgctgacaagcacgtgcctggaagcccgttcactgtgaaggttaccggtgagggt
cgcatgaaggaaagcatcacgcggcggagacaggcaccttccattgccaccattggcagc
acctgtgacctcaatctcaagatcccagggaactggttccagatggtgtctgcccaggag
cgcctgacgcgcaccttcacacgcagcagccacacatacacccgcacagaacgcacggag
atcagcaagacgcgcggcggagagaccaagcgtgaggtgcgggtagaggagtccacccag
gttggtggagaccccttccccgcggtcttcggggacttcttgggccgggagcgcctgggc
tcctttggcagcatcacccggcagcaggagggggaggccagttcccaggacatgactgca
caggtgaccagcccatcgggcaagatggaagccgcagagattgtcgagggagaagacagc
gcgtacagtgtgcgttttgtgccccaggaaatggggccccacacagtcaccgtcaagtac
cgcggccagcacgtacctggcagtccctttcagttcactgtggggccgctgggtgaaggt
ggtgcccacaaagtgcgggctggaggcacaggactggagcgaggtgtggccggtgtgcca
gctgaattcagcatttggacccgagaagctggtgctggaggcctgtctattgccgtggag
ggtcccagcaaggcggagatttcatttgaggaccgaaaagatggctcctgtggggtctcc
tatgttgtccaggaaccaggtgactatgaggtctccatcaagttcaatgatgaacacata
ccagatagtccttttgtggtacctgtggcctccctctcagatgatgctcgccgcctcact
gtcaccagcctccaggaaacagggctcaaggtgaaccagccggcgtcctttgcggtgcag
ctgaatggtgctcggggtgtgattgatgcaagggtgcacacgccctcgggtgcggtggag
gagtgctacgtctctgagctggacagcgacaagcacaccatccgcttcatcccccacgag
aacggcgtccactctattgatgtcaagttcaacggtgcccacatccctggcagtcccttc
aagatccgcgttggggaacagagccaggctggggacccaggcttggtgtcagcttatggt
cctggacttgagggaggcactactggcgtgtcatcagagttcattgtcaacaccctgaat
gcgggctcaggggccttgtctgtcaccatcgatggcccctccaaggtgcagctggactgt
cgggagtgtcctgagggccatgttgtcacttacactcccatggcgcctggcaactacctc
attgccatcaagtacggtggcccccagcacatcgtgggcagccccttcaaggccaaagtc
acaggtccccggctgtctggaggccacagccttcatgaaacatccacagttctggtggag
accgtgaccaaatcctcctcaagccgtggctccagctacagctccatccccaagttctcc
tcggatgccagcaaggtggtgacacggggccctgggctgtcccaggcctttgtgggccag
aagaactccttcaccgtggactgcagcaaagcaggcaccaacatgatgatggtgggcgtg
catgggcccaagaccccctgtgaggaggtgtacgtgaagcacatggggaaccgggtctac
aatgtcacctacaccgtcaaggagaaaggggactacatcctcattgtcaagtggggcgac
gaaagtgttcccggaagccccttcaaagtcaacgtgccctga

DBGET integrated database retrieval system