KEGG   Felis catus (domestic cat): 101081210Help
Entry
101081210         CDS       T02385                                 

Gene name
FLNC
Definition
(RefSeq) LOW QUALITY PROTEIN: filamin-C
  KO
K04437  filamin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04510  Focal adhesion
fca05132  Salmonella infection
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101081210 (FLNC)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    101081210 (FLNC)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    101081210 (FLNC)
  Infectious diseases
   05132 Salmonella infection
    101081210 (FLNC)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     101081210 (FLNC)
  Intermediate filaments
   Intermediate filament-binding proteins
    101081210 (FLNC)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101081210 (FLNC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filamin CH Big_3_5 YtkA
Motif
Other DBs
NCBI-GeneID: 101081210
NCBI-ProteinID: XP_003983071
Ensembl: ENSFCAG00000000954
UniProt: M3VVQ4
Position
A2
AA seq 2720 aa AA seqDB search
MMNNSSYSEAAGLGLGDEVDDMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTD
LQRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDS
KAIVDGNLKLILGLIWTLILHYSISMPMWEDEEDEDARKQTPKQRLLGWIQNKVPQLPIT
NFNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEE
IVDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPHGNTVLQPAHFT
VQTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKNRTYAVSYVPKVAGLHKVTVLFAGQNI
ERSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQG
RRDTVEVALEDKGDSTFRCTYRPVMEGPHTVHVAFAGAPITRSPFPVHVAEACNPNACRA
SGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYHP
VVPGKYVVTITWGGYAIPRSPFEVQVSPEAGAQKVRAWGPGLKTGQVGKSADFVVEAIGT
EVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHIQ
PAAPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDXRAAGKGDLNLYAQDADGCPVNIMVI
PNGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGL
KANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAG
RYTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGK
AKLDVHFAGAAKGEAVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVN
VAPPLDLSKVKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGG
GAETQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGT
PAPFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAH
IPGSPFKATIRPVFDPSKVRASGPGLERGKAGEAATFTVDCSEAGEAELTIEILSDAGVK
AEVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGVKVSGPG
VEPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAY
EEGVHLVEVLYDDVAVPKSPFRVGVTEGCDPTRVRAFGPGLESGLVNKANHFTVETRGAG
TGGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTAGDYDVNITFGGRPIPGSPFRVPVKD
VVDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDKGDG
THTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLP
VEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGD
EIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGEETVITVDAKAAGKGKVT
CTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPMP
HVEEPPDVLQPHRPGPYPTHWATEEPVVPVEPMESMLRPFNLVIPFTVQKGELTGEVRMP
SGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSRHVSAY
GPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLPTAPGD
YSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITESDLSLLTASIRAPS
GNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGDASKVR
VWGKGLSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTYCPTEP
GTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLKIPGNWF
QMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPAVFGDF
LGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKMEAAEIVEGEDSAYSVRFVPQEMGP
HTVTVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAG
GLSIAVEGPSKAEISFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVPVASLS
DDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSELDSDKHT
IRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGTTGVSSE
FIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGPQHIVG
SPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRGPGL
SQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYI
LIVKWGDESVPGSPFKVNVP
NT seq 8163 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacaacagcagctactcagaggccgccggcctcggcctgggcgacgaggtggac
gacatgccgtccacggagaaggacctggcggaggacgcgccgtggaagaagatccagcag
aacacgttcacgcgctggtgcaacgagcacctgaagtgtgtgggcaagcgcctgaccgac
ctgcagcgagacctcagcgacgggctgcgcctcatcgcgctgctcgaggtgctcagccag
aagcgcatgtatcgcaagttccacccgcgccccaacttccgccagatgaagctggagaac
gtgtccgtggccctcgagttcctggagcgcgagcacatcaagctcgtgtccatcgacagc
aaggccattgtggatgggaacctgaagctgatcctgggtctgatctggacgctgatccta
cactactccatctccatgcccatgtgggaggatgaggaggacgaggacgcccgcaagcag
acgcccaagcagcgtctgctcggctggatccagaacaaggtgccccagctgcccatcact
aacttcaaccgtgactggcaggatggcaaagctctgggcgccctggtggacaactgtgcc
cctggcctgtgccctgactgggaagcctgggaccccaaccagcctgtggagaacgcccgg
gaggccatgcagcaggcggacgactggctcggggtgccccaggtgattgcccccgaggag
attgtggaccccaacgtggatgagcattctgtcatgacctacctgtcccagttccccaag
gccaaactcaaacctggtgcccctgttcgctctaaacagctgaaccctaagaaggccatc
gcctacgggcctggcatcgagccccacggcaacactgtgctacagcctgcccacttcacc
gtgcagacggtggatgccggcgtgggcgaggtgctggtctacattgaggaccctgagggc
cacaccgaggaggccaaagtggttcccaacaatgacaagaaccgcacctatgctgtctcc
tatgtgcccaaggttgcggggttgcacaaggtgactgtgctctttgctggccagaatatc
gaacgcagtccctttgaggtgaacgtgggcatggctctgggagatgccaacaaggtgtca
gcccgtggccctggcctggagcctgtgggcaatgtggccaacaaacccacgtactttgac
atctatactgcgggggccggcactggtgatgttgccgtggtgatcgtggacccgcagggc
cggcgggacacagtggaggtggccctggaggacaagggcgacagcacgttccgatgcacg
tacaggcctgtgatggaggggccccacacggtgcatgtggccttcgctggtgcccccatc
acccgcagtcctttccccgtccatgtagctgaagcctgtaaccctaacgcctgccgtgcc
tctgggcggggcctgcagcccaagggtgtgcgtgtgaaagaggtggctgatttcaaggtg
ttcactaagggtgccggcagcggggagctcaaggtcacagtcaaagggccaaagggcaca
gaagagccagtgaaagtgcgagaggctggagatggcgtgttcgagtgtgagtaccaccct
gtggtgcctgggaagtatgtggtgaccatcacgtggggcggctacgccatcccccgcagt
ccttttgaggtacaggtgagcccagaggcaggagcgcagaaggtacgggcctggggtccc
ggcctgaaaactggccaggtggggaagtcggccgactttgtggtggaggccattggcacg
gaggtggggacactgggattctccattgaggggccctcacaggccaagatcgagtgtgat
gacaagggggatggctcctgcgatgtgcggtactggcccacggagcctggggagtacgcc
gtgcacgtcatctgcgatgatgaggacatccgagactcacccttcattgcccacatccag
ccagccgcacctgactgcttcccggataaggtgaaggcctttgggcctggcctggagccc
actggctgcatcgtggacaagcctgcagagttcaccatcgatngccgtgctgctggcaag
ggagacctgaacctgtatgcccaggatgctgatggctgccctgtcaacatcatggtcatc
cccaatggcgacggcaccttccgctgctcctacgtgcccaccaagcccattaaacacacc
atcatcatctcctggggaggcgtcaatgtgcccaagagccccttccgggtgaacgtggga
gaaggcagtcaccccgagcgggtgaaggtatatggcccaggcgtggagaagacgggcctc
aaggccaacgagcctacctatttcaccgtggactgcagcgaggctgggcaaggtgacgtg
agtatcggcatcaagtgtgctcccggagtggtgggccctgcagaagctgacatcgacttt
gacatcatcaagaacgacaatgacaccttcacagtcaagtacacccccccaggggccggc
cgctacaccattatggtgctgtttgccaaccaggagatccctgccagccccttccacatt
aaggtggacccatcccacgatgccagcaaagtcaaggctgagggccctgggctgaaccgc
acgggtgtggaagtcgggaagcccactcacttcacggtgctgaccaagggagccggcaag
gccaagctggacgtgcactttgccggggctgccaagggtgaggccgtgcgggactttgaa
atcatcgacaaccatgactactcctacactgtcaagtacacagccgtccagcagggcaac
atggcagtgacggtgacctacggtggggaccctgtccccaagagcccctttgtggtgaat
gtggcacccccactggacctcagcaaagtcaaagttcaaggcctgaacagcaaggtggct
gtggggcaagaacaggccttctctgtgaacacacgtggggctggcggtcaagggcagctg
gatgtgcggatgacttcaccctcccgtcgccccatcccttgcaagctggagcctgggggc
ggagctgaaacccaggccgtgcgctacatgccccctgaggagggaccctacaaggtggac
atcacctacgacggtcacccagtgcccggtagcccctttgctgtggagggtgtcctgccc
cctgatccctccaaggtttgtgcgtatgggcccggtctcaagggcggcctggtaggcacc
ccggcaccgttctccattgacaccaagggggctggcacgggcggcctggggctgactgtg
gagggcccctgtgaggccaagattgagtgccaggacaacggtgatggctcatgtgctgtc
agctacctgcccacggagcccggcgagtacaccatcaacatcctgtttgccgaagcccac
atccctggctcacccttcaaggccaccatccggcccgtgttcgacccgagcaaggtgcgg
gccagtgggccgggcctggagcgtggcaaggctggcgaggcggccaccttcacggtggac
tgctcggaggctggcgaggctgagctgaccatcgagatcctgtcggacgccggtgtcaag
gccgaggtgctgatccacaacaatgccgacggcacctaccacatcacctacagccccgcc
tttcctggcacctacacaattaccatcaagtatggcgggcaccctgtccccaaattccct
acccgcgtccacgtgcagcctgctgtcgacaccagtggagtcaaggtctcagggcccggg
gtggagcctcacggtgtcctgcgtgaggtgaccactgagttcactgtggacgcaagatcc
ctaacagccacaggtgggaaccacgtgacagctcgtgtgctcaacccctcgggtgctaag
acggacacctatgtgacagacaacggggacggcacctaccgagtgcagtacacagcctat
gaagagggcgtgcatctggtggaggtcctgtatgatgacgtagctgtgcccaagagcccc
ttccgagtgggcgtgaccgagggctgtgaccccacccgcgtgagggcctttgggcctggc
ctggagagcggcttggtcaacaaggccaaccacttcactgtggagaccaggggagctggc
accggaggcctcggcctagccatcgagggcccctcagaagccaagatgtcctgcaaggac
aacaaagatggtagctgtaccgtggagtacatccctttcaccgctggagactacgacgtc
aacatcacctttggggggcggcccatcccagggagcccgttccgggtgccggtgaaggat
gtggtggaccctgggaaggtgaagtgctcagggccggggctgggggccggtgtcagggcc
cgggtaccccagaccttcacggtggactgcagccaagccggccgggccccactgcaagtg
gccgtgctgggccccacaggtgtagccgagcctgtagaggtgcgtgacaagggagatggc
acccacaccgtccactacaccccagccaccgatgggccctacacggtagccgtcaagtat
gccgaccaggaggtaccacgcagccctttcaagatcaaggtgcttcctgcccatgatgcc
agcaaggtgcgggccagcggccccggcctcaacgcctctggcatccctgccagcctgccc
gtggagttcaccatcgatgcccgggatgccggtgagggtttgctcaccgtccagatcctg
gacccggagggaaagcccaagaaagccaacatccgagacaacggggatggcacgtacact
gtgtcctacctgccagacatgagtggccggtacaccatcaccatcaagtatggcggcgac
gagatcccctactcgcccttccgcatccacgccctgcccactggggatgccagcaagtgt
cttgtcacagtgtccattggaggccatggcctgggtgcctgcttgggaccccgcatccag
atcggggaggagacagtgatcacggtggacgccaaggcggcaggcaaggggaaggtgacg
tgcacggtgtccactccggatggggcggagctcgacgtggatgtggttgagaaccacgac
ggtacctttgacatctactatacagcgcccgagccgggcaagtacgtcatcaccatccgc
tttggaggcgagcacatccccaacagccccttccacgtgctggcgtgtgaccccatgccc
cacgtggaggagcctcccgatgtgctgcagccgcaccggcccggcccctaccccacacac
tgggccacagaggagccagtggtgcctgtagagccaatggagtccatgcttaggcccttc
aacctggtcatccccttcaccgtgcagaaaggggagctcacaggggaggtacggatgccc
tctgggaaaacagcccggcccaacatcaccgacaataaggatggaaccatcacggtgagg
tatgcacccaccgagaaaggcctgcaccagatggggatcaagtatgacggcaaccacatc
cctggaagccccctgcagttttatgtggatgccatcaatagccgccatgtgagtgcttat
gggccaggcctgagccatggcatggttaacaagccggccaccttcaccattgtcaccaag
gatgctggggaagggggcctgtccctggctgtggagggcccatccaaggcagagatcacc
tgcaaggacaacaaggacggcacctgcaccgtatcctacttacccacagcgcctggagac
tacagcatcatcgtgcgctttgatgacaagcacatcccaggaagccccttcacggccaag
atcacaggcgatgactccatgaggacatcacagctcaatgtgggcacctccacggatgtg
tcactgaagatcacggagagtgacctgagcctgctgactgccagcatccgcgccccctca
ggcaacgaggagccctgcctattgaagcgcctgcccaacaggcacatcggcatctccttc
accccgaaggaggttggggagcacgtggtaagcgtgcgcaaaagtggcaagcatgtcacc
aacagccccttcaagatcctggtggggccatctgagatcggagatgccagcaaggtgcgg
gtctggggcaagggcctgtccgagggacacaccttccaggtggcggagttcatcgtggac
actcgcaacgcaggttacgggggcctggggttgagtattgaaggccctagcaaggtggac
atcaactgtgaggacatggaagatggcacatgcaaagtcacctactgccccaccgagcct
ggcacctacatcatcaacatcaaatttgctgacaagcacgtgcctggaagcccgttcact
gtgaaggttaccggtgagggtcgcatgaaggaaagcatcacgcggcggagacaggcacct
tccattgccaccattggcagcacctgtgacctcaatctcaagatcccagggaactggttc
cagatggtgtctgcccaggagcgcctgacgcgcaccttcacacgcagcagccacacatac
acccgcacagaacgcacggagatcagcaagacgcgcggcggagagaccaagcgtgaggtg
cgggtagaggagtccacccaggttggtggagaccccttccccgcggtcttcggggacttc
ttgggccgggagcgcctgggctcctttggcagcatcacccggcagcaggagggggaggcc
agttcccaggacatgactgcacaggtgaccagcccatcgggcaagatggaagccgcagag
attgtcgagggagaagacagcgcgtacagtgtgcgttttgtgccccaggaaatggggccc
cacacagtcaccgtcaagtaccgcggccagcacgtacctggcagtccctttcagttcact
gtggggccgctgggtgaaggtggtgcccacaaagtgcgggctggaggcacaggactggag
cgaggtgtggccggtgtgccagctgaattcagcatttggacccgagaagctggtgctgga
ggcctgtctattgccgtggagggtcccagcaaggcggagatttcatttgaggaccgaaaa
gatggctcctgtggggtctcctatgttgtccaggaaccaggtgactatgaggtctccatc
aagttcaatgatgaacacataccagatagtccttttgtggtacctgtggcctccctctca
gatgatgctcgccgcctcactgtcaccagcctccaggaaacagggctcaaggtgaaccag
ccggcgtcctttgcggtgcagctgaatggtgctcggggtgtgattgatgcaagggtgcac
acgccctcgggtgcggtggaggaatgctacgtctctgagctggacagcgacaagcacacc
atccgcttcatcccccacgagaacggcgtccactctattgatgtcaagttcaacggtgcc
cacatccctggcagtcccttcaagatccgcgttggggaacagagccaggctggggaccca
ggcttggtgtcagcttatggtcctggacttgagggaggcactactggcgtgtcatcagag
ttcattgtcaacaccctgaatgcgggctcaggggccttgtctgtcaccatcgatggcccc
tccaaggtgcagctggactgtcgggagtgtcctgagggccatgttgtcacttacactccc
atggcgcctggcaactacctcattgccatcaagtacggtggcccccagcacatcgtgggc
agccccttcaaggccaaagtcacaggtccccggctgtctggaggccacagccttcatgaa
acatccacagttctggtggagaccgtgaccaaatcctcctcaagccgtggctccagctac
agctccatccccaagttctcctcggatgccagcaaggtggtgacacggggccctgggctg
tcccaggcctttgtgggccagaagaactccttcaccgtggactgcagcaaagcaggcacc
aacatgatgatggtgggcgtgcatgggcccaagaccccctgtgaagaggtgtacgtgaag
cacatggggaaccgggtctacaatgtcacctacaccgtcaaggagaaaggggactacatc
ctcattgtcaagtggggcgacgaaagtgttcccggaagccccttcaaagtcaacgtgccc
tga

DBGET integrated database retrieval system