KEGG   Felis catus (domestic cat): 101081257Help
Entry
101081257         CDS       T02385                                 

Gene name
CLTCL1
Definition
clathrin, heavy chain-like 1
Orthology
K04646  
clathrin heavy chain
Organism
fca  Felis catus (domestic cat)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:fca00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    101081257 (CLTCL1)
   04142 Lysosome
    101081257 (CLTCL1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101081257 (CLTCL1)
  Nervous system
   04721 Synaptic vesicle cycle
    101081257 (CLTCL1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    101081257 (CLTCL1)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    101081257 (CLTCL1)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101081257 (CLTCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
D3
AA seq 1586 aa AA seqDB search
MAQILPIRFQEHFQLQNLGINPANIGFSTLTMESDKFICVREKVGEQAQVVIVDMSDPMA
PIRRPISAESAIMNPASKVIALKGMGQNRVVGAMQLYSVDRKVSQPIEGHAAAFAEFKSE
GNAKPATLFCFAVRSPTGGKLHIIEVGQPAAGNQPFVKKAVDVFFPPEAQTDFPVAMQIG
GKHGVIYLITKYGYLHMYDLESGVCIYMNRISADTIFVTAPHESTSGIIGVNKKGQVLSV
CVEEDNIVNYATSVLQNPDLGLRLAIRSNLAGAEELFVRKFTTLFAQGSYAEAAKVAASA
PKGVLRTSDTVRKFQSIPAQPGQASPLLQYFGILLDQGQLNKLESLELCRLVLQQGRKQL
LEKWLKEDKLECSEELGDLVKTADPTLALSVYLRANVPSKVIQCFAETGQFQKIVLYAKK
VGYTPDWIFLLRSVMRISPDQGLQFSQMLVRDEEPLANIDQIVDVFMENSLIQQCTSFLL
DALKNNRPAEGHLQTRLLEMNLIHAPQVADAILGNQMFTHYDRAHIAQLCEKAGLLQRAL
EHYTDLYDIKRAVVHTHLLNPEWLVSFFGSLSVEDSLACLHALLSASIRQNLQLCVQVAS
KYHEQLGTQSLVELFESFKSYEGLFYFLGSIVNFSQDPDVHLKYIQAACKTGQIKEVERI
CRESNCYNPERVKNFLKEAKLTDQLPLIIVCDRFDFVHDLVLYLYRNNLQKYIEIYVQKV
NPSRIPAVVGGLLDVDCSEEVIKNLIMVVRGQFSTDELVAEVEKRNRLKLLLPWLESRSH
EGCEEPATHNALAKIYIDSNNSPERFLRENAYYDSRVVGRYCEKRDPHLACVAYERGQCD
LELIKVCNENSLFKSEARYLVRRKDPELWAHVLEETNPSRRQLIDQVVQTALSETQDPEE
VSVTVKAFMTADLPNELIELLEKIVLDNSVFSEHRNLQNLLILTAIKADRTRVMEYISRL
DNYDAPDIANIAVSSALYEEAFTIFRKFDVNASAIQVLIEHIGNLDRAYEFAERCNEPAV
WSQLACAQLQKDLVKEAIDSYIRADDPSSYLEVVQAASRNNNWEDLVKFLQMARRKGRES
YIETELIFALAKTGRLSELEDCINGPNNAHIQQVGDRCYEEGMYEAAKLLYSSVSNFARL
ASTLVHLGEYQAAVDSSRKANSTRTWKEVCFACVDGQEFRLAQLCGLHIVIHADELEELI
RYYQDRGYFEELISLLEAALGLERAHMGMFTELAILYSKFKPQKMPEHLELFWSRVNIPK
VLRAAEQAHLWAELVFLYDKYEEYDNAVLTMINHPTDAWREGQFKDVIAKVANVELYYKA
LQFYLDYKPLLINDLLLVLAPRLDHTRTVGFFSKAGQLPLVKPYLRSVQSHNNKSVNEAL
NHLLTEEEDYQGLRASIDAYDNFDNIALAQRLEKHQLIEFRRIAAYLYKGNNRWAQSVEL
CKKDHLYKDAMQHAAESRDAELAEKLLQWFLEEGKRECFAASLFTCYDLLPPDVVLELAW
RHNLVDLAMPYFIQVMREYLSKVDRLDASESLRKQEEHVVEPAPLLFGQQLMLTAGPAAG
PAPAGFPYGYAAAPAFAQPPVYGFSV
NT seq 4761 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagatcctccccatccgcttccaggagcacttccagctccaaaacctgggaatt
aatccagccaacattggattcagcacactgaccatggaatctgataagtttatatgtgtc
cgagaaaaggttggtgagcaggcacaggtagtgattgttgacatgagtgatccaatggca
ccaatcagacggcccatctctgcagaaagtgccatcatgaatccagcctctaaggtgata
gctttgaaaggcatggggcaaaaccgtgtagttggggcaatgcaactctactctgtggat
aggaaagtttcacaacccatagaaggccatgctgctgcttttgcagagttcaagagcgaa
gggaatgccaagcctgccacccttttctgctttgctgtacgtagtcccacagggggcaag
ttgcacataatcgaagtcggacagcctgcagcaggaaaccagccttttgtaaagaaagct
gtggatgtgtttttccctccagaggctcagactgatttcccagtggctatgcagattgga
ggtaaacatggtgttatttacttgatcacgaaatatggctatcttcacatgtatgaccta
gagtctggcgtgtgcatctacatgaaccgtatcagtgctgacacgatatttgtcactgct
ccacatgaatctacttctggaattattggtgtcaacaaaaagggacaggtgctgtcagtt
tgtgtcgaggaagataacattgtgaattatgcaaccagtgtgcttcaaaatccagacctt
ggtctgcgcttggccattcgtagtaacttggctggggcggaggagttattcgtgagaaaa
ttcactaccctctttgcacaggggagctatgctgaagccgccaaagtagcagcatctgca
ccaaagggagtcctgcgtaccagtgacacagttcggaagttccaaagtattcccgcccag
cctgggcaggcctctcctttgctccagtactttggaatcctccttgaccagggtcagctc
aataaacttgaatccttagaactttgccgtctagtgcttcagcagggtcgcaagcaactc
ttagaaaagtggctgaaagaagataagctggagtgttcagaagaacttggagatttggtc
aaaactgctgaccctacacttgctctgagtgtgtatcttcgggcaaatgtgccgagcaag
gttatccagtgttttgcagaaacaggccaattccagaaaattgtcctctatgccaaaaag
gttggctataccccagactggatctttttactgaggagtgtgatgagaatcagtccagac
cagggcctgcagttttctcaaatgctagtgcgagacgaggagccattggccaatattgac
cagattgtagacgttttcatggaaaacagtttaattcagcagtgtacctccttcttgttg
gatgccttgaaaaataaccgcccagctgaggggcacctccagacgcgcctgttggagatg
aacctgattcacgcaccccaggttgcagatgccattcttggaaatcagatgtttacccat
tatgatcgggcccacatcgcccagctctgtgaaaaggcaggcctcctgcagcgtgcgctg
gagcactacactgacctgtatgacatcaagagggctgtggtccacactcacctcctcaat
cccgagtggctcgtcagcttctttggctccttgtcagtggaggattctttggcgtgtctt
catgctttgctgtctgccagcatcagacagaaccttcagctgtgtgtgcaggtagcctcc
aagtaccatgagcagctgggcacacagtccctggtggagctctttgaatccttcaagagt
tacgaaggcctcttctacttcctgggctcaattgtgaacttcagccaagatccagatgtg
cacttgaaatacattcaggctgcctgtaagacgggacagatcaaggaggtggagaggata
tgccgggagagtaattgctacaacccagagcgggtgaagaattttctgaaggaggccaag
ctcacagaccagcttcctctcatcatcgtgtgtgatcggtttgactttgtacatgacctc
gtcctgtacttataccgcaacaacctgcagaagtacatcgaaatctacgttcagaaggtc
aaccctagccggatccctgctgtggttggagggctgcttgatgtggattgttctgaggaa
gtaattaaaaacttaatcatggtggtgagaggacagttctccactgatgagctggtggct
gaagtagaaaaaagaaacaggctaaagctgcttcttccctggctggagtcccggagtcac
gaaggctgtgaagagcctgccactcacaatgctcttgccaagatctacatcgacagcaac
aacagccccgagcgcttcctgagagaaaatgcttactatgacagccgcgtggtgggccgc
tactgtgagaagcgggacccacatctggcctgcgttgcctatgagcgggggcagtgtgac
cttgagctcatcaaggtttgcaatgagaattctctgttcaaaagtgaggcccgttacttg
gtgcgcaggaaagatccagagctctgggctcatgtccttgaggagaccaacccttccagg
cgacagctgattgaccaggtggtacagacagcattgtcagaaacacaggatcctgaagag
gtctcagtcactgtcaaggccttcatgacagctgatctgcctaatgaactgattgagctg
ctggagaagattgttctggataactcagtctttagtgagcacaggaatctccagaatttg
ctgatcctgactgccatcaaggcagaccgcacgcgggtcatggaatacatcagccgcctg
gacaactacgatgccccagacattgcgaacatcgccgttagtagtgcactgtatgaggag
gccttcaccatctttcgcaagtttgatgtgaatgcatcagcaatccaggtcctgattgag
cacattggaaacctagaccgagcatacgagtttgcagagagatgcaatgaacctgctgtg
tggagtcagctggcctgcgcccagctccagaaagacttggtgaaggaagccatcgactcc
tacatcagagctgacgacccttcctcttacttggaagtcgttcaggcagccagtaggaac
aacaattgggaagatctggtgaaattcctacagatggccaggagaaagggccgtgaatcc
tatatagagactgaacttatttttgccctggctaaaactggtcgcctgtctgagttagaa
gattgtattaatggacccaacaatgcccacatccaacaggttggagaccgctgttacgag
gagggaatgtatgaggctgctaagctgctctacagcagtgtttctaactttgcccgcctg
gcttccaccctggtccaccttggagagtatcaggcagccgtggacagcagccgcaaagcc
aacagcacccggacgtggaaggaggtatgctttgcatgcgtggatgggcaggagttccgc
cttgcacaactgtgtggtcttcacattgtcattcacgcagatgagctggaggagctgata
cgctattaccaggatcggggctactttgaggaactgatctccctgctggaggcagccctg
ggcctggagcgggcccacatgggcatgttcacagaactggccatcctctactccaaattc
aagcctcagaagatgccagagcacctggagctcttctggtcccgagtcaacatcccaaag
gtgctgagagctgcagagcaggcgcacctctgggcagagctggtgttcctctatgacaag
tacgaagagtacgataatgccgtccttaccatgatcaatcaccctactgatgcctggagg
gaagggcaattcaaggatgtcattgccaaggttgctaatgtggagctctactataaagcc
ctgcagttctatttggattacaaacctctgctcataaatgacctgttgcttgtgcttgca
ccccggctggaccatacccggactgttggcttcttttcaaaggcaggccagttgccccta
gtgaagccttacctgcggtcagtccagagccacaacaacaagagtgtgaatgaggccctc
aaccacctactgacagaagaggaggattaccagggtttgagggcatctatcgatgcctac
gacaactttgacaacattgccctggcacagaggttggagaagcaccagctgattgagttc
aggcgcattgcagcttatctatacaagggcaacaaccggtgggcccagagcgtggagctc
tgcaagaaggaccatctctacaaggatgccatgcagcatgctgcagagtctagagatgcc
gagctggccgagaagttgctgcagtggttcctggaagagggcaagcgggagtgcttcgcg
gcctctctcttcacctgctacgacctgcttcctccagatgtggtgctggagctggcctgg
agacacaacctcgttgacctggccatgccctacttcatccaggtgatgagagagtacctt
agcaaagtagacagactggatgcctcggagagcctacgcaagcaagaggaacatgtggtg
gagcctgcccctctcttgtttggccagcagctgatgctgacagcaggccctgctgcaggc
cctgcccctgctggcttcccctatggatatgctgctgcacctgccttcgcccagcctcct
gtgtacggcttcagcgtgtag

DBGET integrated database retrieval system