KEGG   Felis catus (domestic cat): 101081273Help
Entry
101081273         CDS       T02385                                 

Gene name
RXRG
Definition
retinoid X receptor, gamma
Orthology
K08526  
retinoid X receptor gamma
Organism
fca  Felis catus (domestic cat)
Pathway
PPAR signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    101081273 (RXRG)
   03320 PPAR signaling pathway
    101081273 (RXRG)
   04919 Thyroid hormone signaling pathway
    101081273 (RXRG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101081273 (RXRG)
   05202 Transcriptional misregulation in cancers
    101081273 (RXRG)
   05216 Thyroid cancer
    101081273 (RXRG)
   05222 Small cell lung cancer
    101081273 (RXRG)
   05223 Non-small cell lung cancer
    101081273 (RXRG)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    101081273 (RXRG)
Nuclear receptors [BR:fca03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   101081273 (RXRG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
F1
AA seq 463 aa AA seqDB search
MYGNYSHFMKFPAGFGGSPGHSSSTSMSPLTALSTGKPMDSHPNYTDTPVSAPRTLSAVG
TPLNALGSPYRVIASAMGPPSGALAAPAGINLVAPPSSQLNVVNSVSISEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLMYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKAELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtatgggaattattctcacttcatgaagtttcccgcaggctttggcggctcccccggc
cactccagctccacgtctatgagcccattgacagccttgtccacagggaagccaatggac
agccaccccaactacacggacacccccgtgagtgccccacggactctgagcgcggtgggg
acacccctcaatgccctgggctctccatatagagtcatcgcctctgccatgggcccaccc
tcaggagcactggctgcgcctgcgggaatcaatctggttgccccgcccagctctcagcta
aatgtggtcaacagtgtcagcatttcagaggacatcaagcccttaccagggcttcctggg
attggaaacatgaactacccatcaaccagccccggatccctggttaaacacatctgtgcc
atctgcggggacagatcctcaggaaagcactatggtgtgtatagctgtgaaggctgcaaa
ggcttcttcaagagaaccatacgcaaggacctcatgtacacatgccgggataacaaggac
tgcctcattgacaagcgtcagcggaatcgctgtcagtactgccgctaccagaagtgcctg
gtgatgggcatgaagagagaagctgtgcaagaagaaaggcagaggagccgggagcgggcc
gagagtgaggccgaatgtgccagtagtggccacgaagatatgcctgtggagaggattcta
gaagctgagcttgctgttgaaccaaagacggaatcctatggtgacatgaatatggagaac
tcgacgaacgaccctgtcacgaacatatgccatgctgctgataagcagcttttcactctt
gtcgaatgggccaagcgcatcccccacttctctgacctcaccttggaggaccaggtcatc
ctgctccgggcagggtggaacgaactgctaattgcctccttctcccaccgctccgtctcc
gtgcaggacggcatccttctggccaccggcttacatgtccaccgcagcagcgcccacagc
gctggggtcggctccatctttgacagagtcctgactgagctggtctccaaaatgaaagac
atgcagatggacaaggcggagctggggtgcctgcgggccatcgtgctgtttaacccagat
gccaagggtctgtccaacccctcggaggtagagactctgcgagagaaggtttatgccacc
ctcgaggcctacacgaagcagaagtatccggaacaacctggcaggtttgccaagctgctg
ctgcgcctcccggccctgcgctccattggcctgaagtgcctggagcacctgtttttcttc
aagctcatcggggacacgcccattgacaccttcctcatggagatgttggagaccccgctg
caaatcacctga

DBGET integrated database retrieval system