KEGG   Felis catus (domestic cat): 101081341Help
Entry
101081341         CDS       T02385                                 

Gene name
CLTC
Definition
(RefSeq) clathrin, heavy chain (Hc)
  KO
K04646  
clathrin heavy chain
Organism
fca  Felis catus (domestic cat)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:fca00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    101081341 (CLTC)
   04142 Lysosome
    101081341 (CLTC)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101081341 (CLTC)
  Nervous system
   04721 Synaptic vesicle cycle
    101081341 (CLTC)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    101081341 (CLTC)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    101081341 (CLTC)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101081341 (CLTC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
E1
AA seq 1682 aa AA seqDB search
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN
PIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGI
LLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYL
RANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDE
EPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSV
EDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQF
STDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWGSVL
LESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAICNELFEEAFAIFRKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEV
VQAANTSGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQ
VGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFAC
VDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMN
HPTDAWKEGQFKDIITKVANVELYYRAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFS
KVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLE
KHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQE
EKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDAIKEKVDKL
DASESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGY
SM
NT seq 5049 nt NT seq  +upstreamnt  +downstreamnt
atggcccagattctgccaattcgttttcaggagcatctccagctccagaatctgggtata
aacccagcaaatattggcttcagtaccctaactatggagtcagacaaattcatctgcatt
agagagaaagtaggagagcaggcccaggtggtaatcattgatatgaatgacccaagtaat
ccaattcgaagaccaatttcagcagacagcgccatcatgaatccagcaagcaaagtaatt
gcactgaaagctgggaaaactcttcagatatttaacattgaaatgaaaagtaaaatgaag
gcccataccatgactgatgatgtcactttctggaaatggatctctttgaatacggttgct
cttgttacggataatgcagtttatcattggagtatggaaggagagtctcagccagtgaaa
atgtttgatcgccattctagccttgcagggtgccagattatcaattatcgtacagatgca
aagcaaaagtggttacttctgactggcatatctgcacagcaaaatcgtgtggtgggagct
atgcagttatattctgtagataggaaagtatctcagcccattgaaggacacgcggctagt
tttgcgcaatttaagatggaaggaaatgcagaagaatcaacgttattttgttttgcagta
cggggtcaagctggagggaagttacatatcattgaagttggcacaccacctacagggaat
cagccctttccaaagaaggcagtggatgttttctttcctccagaagcacaaaatgacttt
cctgttgcaatgcagatcagtgaaaagcatgatgtagtgttcttgattactaagtatggt
tatatccacctctatgatcttgagactggtacctgtatctacatgaatagaatcagtgga
gaaacaatctttgttactgcacctcatgaagccacagctggaataattggagtaaacaga
aagggacaagttctgtcagtatgcgtggaagaagaaaacataattccttatatcaccaat
gtcctacaaaatcctgatttggctctgagaatggctgtacgtaataacttagctggtgct
gaagaactctttgcccggaaatttaatgctctttttgcccagggaaattactcagaggca
gcaaaggtagctgctaatgcaccaaagggaatccttcgtactccagacactatccgtcgg
ttccagagtgtcccagcccagccaggccaaacttctcctctacttcagtactttggaatt
ctcttggaccagggccaactaaacaaatatgaatccttagaactatgtaggcctgtactt
cagcaaggacggaaacagcttttggagaaatggttaaaagaagataagctggaatgttct
gaagaactgggtgatcttgtgaaatctgtggaccctaccttggcacttagtgtgtacctg
agggctaacgtcccaaataaagtaattcagtgctttgcagaaacaggtcaagtccagaag
attgttttatatgctaaaaaagttggatatactccagactggatatttttgctgagaaat
gtcatgcgtatcagtccagatcagggacagcagtttgctcaaatgttagttcaggatgaa
gaaccacttgctgatatcacacagattgtggatgtctttatggaatacaatctaattcag
cagtgtactgcattcttgcttgatgccctgaagaataatcgcccatctgaaggtccttta
cagacacggttgcttgagatgaaccttatgcatgcacctcaggttgcagatgctattcta
gggaatcagatgtttacacattatgaccgggctcatattgctcagctgtgtgaaaaggct
ggtctactgcagcgtgcattagaacacttcactgatttatatgacataaagcgtgcagtt
gttcacacccatcttcttaaccctgagtggttagtgaattactttgggtccttatcagta
gaagactccctagaatgcctcagggccatgctgtctgccaatattcgtcagaatctgcag
atctgtgttcaagtggcttccaagtatcatgaacaactgtcaactcaatctctgattgaa
ctttttgaatctttcaagagttttgaaggtctcttttattttcttggatccattgttaac
tttagtcaggacccagatgtgcactttaagtatattcaggcagcttgcaagactgggcag
atcaaagaagtagaaagaatctgcagagaaagcaactgctatgatcctgagcgagtcaag
aattttctcaaggaagcgaagctaacagatcagttaccacttatcattgtgtgtgatcgg
tttgactttgttcatgatttggtgctctatttatatagaaataatcttcaaaagtatata
gagatatatgtacagaaggtgaatccgagtcgacttcctgtggttattggaggattgctt
gatgttgattgctctgaagatgtcattaaaaatttgattcttgttgtaagaggtcaattc
tctactgatgagcttgtagctgaggttgaaaaaagaaacagattgaaactgcttctgcct
tggctagaggccagaattcatgagggctgtgaggagcctgctactcacaacgcattagcc
aaaatctacatagacagtaataacaacccagagagatttcttcgtgaaaatccttattat
gacagtcgtgttgttggaaagtattgtgagaagagagatccacatttggcttgtgttgct
tatgaacgtggccagtgtgatctggaacttattaatgtttgcaatgagaattccctcttc
aaaagtctttcccgctatttggtacgccgaaaggatccagaattatggggtagtgtgctg
ctggaaagtaatccttacaggagaccccttattgaccaggttgtacagacagccttgtct
gaaactcaggaccctgaagaagtgtcagtaactgtcaaggcttttatgactgcagacctt
cctaatgaactcattgaactgctggagaaaattgtccttgataactctgtattcagtgaa
cacaggaatttgcaaaacctcctcatcctcactgcaatcaaggctgaccgtacacgtgtt
atggagtatattaaccgcctggataattatgatgccccagatattgccaatatcgcaatc
tgcaatgagttgtttgaagaagcatttgccattttccggaaatttgatgtcaatacttca
gcagtgcaggtcttgattgaacatattggaaacttggaccgggcatatgagtttgctgaa
cgctgcaatgaaccagcggtctggagtcagcttgcaaaagcccagttgcagaaaggaatg
gtgaaagaagccattgattcttacatcaaagcggatgatccttcatcctacatggaagtt
gttcaggctgccaacaccagtggaaactgggaagaactagtgaagtacttgcagatggcc
cgtaagaaggctcgtgaatcctatgtggagacagaattgatatttgcactggctaaaaca
aaccgccttgcagagttggaagagttcatcaatgggccaaataatgctcatatccaacaa
gttggtgatcgttgttatgatgaaaaaatgtatgatgctgctaaattactgtacaacaat
gtctccaattttggacgcttggcatctaccctcgttcacctgggtgaatatcaggcagct
gttgatggagctaggaaagctaatagtactcgaacatggaaagaggtctgcttcgcctgt
gtagatggcaaggagttccgtctagctcaaatgtgtgggcttcatattgtagtacatgca
gatgaattggaggaacttatcaactactatcaggaccgaggatactttgaagaactgata
accatgttggaagcagcactgggacttgagcgagctcatatgggaatgtttaccgaatta
gctattctatattctaaatttaagccacagaaaatgagggagcatctggagctgttctgg
tccagagtgaatattcctaaggtgcttagagctgcagaacaagctcatctctgggcagaa
ttggtgtttttgtatgacaagtatgaagagtatgataatgccataattactatgatgaac
catccaactgatgcatggaaagaagggcagttcaaagatattattaccaaggttgccaat
gtggaactatactacagagcaatacagttctacctagaattcaagcctctgttgttaaat
gatttgctgatggtgctgtctccacggttggatcatactcgtgctgtcaattatttcagc
aaggttaaacagctaccactggtgaaaccatatttgcgttcagttcaaaaccacaacaac
aagtctgtgaatgaatcactgaacaacctctttattaccgaagaagattatcaggctctg
cgaacatctatagatgcttatgacaactttgacaatatctcacttgctcagcgtttggaa
aaacatgaactcattgagttcagaagaattgctgcttatctcttcaaaggcaacaaccgc
tggaaacagagtgtagagctgtgcaagaaagacagcctgtacaaggatgcaatgcagtat
gcctctgaatctaaagatactgaattggctgaagaactcctacagtggtttttgcaggaa
gaaaaaagagagtgctttggagcttgtctttttacctgttatgatcttttaaggccagat
gttgtccttgaaactgcatggaggcacaatatcatggattttgccatgccctatttcatc
caggtcatgaaggaatacttgacaaaggttgatgcaataaaggaaaaggtggataaatta
gatgcttcggaatcactgagaaaagaagaagaacaagctacagagacgcaacctatcgtt
tatggtcagccccagttgatgctgacagcaggacccagtgttgcagtccctccccaggca
ccttttggctatggttatactgcaccaccctatgggcagccacagcctggctttgggtac
agcatgtga

DBGET integrated database retrieval system