KEGG   Felis catus (domestic cat): 101081345Help
Entry
101081345         CDS       T02385                                 

Gene name
SPHK2
Definition
sphingosine kinase 2
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
fca  Felis catus (domestic cat)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:fca00600]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:fca04370]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:fca04020]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:fca04666]
Human Diseases; Infectious diseases; Tuberculosis [PATH:fca05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
E2
AA seq 600 aa AA seqDB search
MNGHLETEEQGDQALHVQRLRPKPEARPRGGLVPLAEVSGCCTLRSRSPSDAAAAYFCIY
TYPQGRRGGRRRAARTFRVDGAATYEENRAEAQRWATALMCLLRGLPLPGDGEITPELLP
KPPRLLLLVNPLGGRGLAWQWCKTHVLPMISEAGLSFNLIQTERQNHARELVQGLRLSEW
DGIVTVSGDGLLFEVLNGFLDRPDWEEAVKTPVGILPCGSGNALAGAVNQHGGFEPALGV
DLLLNCSLLLCRGGSRPLDLMSVTLASGSRCLSFLSVAWGFVSDVDIQSERFRALGSARF
TLGTVLGLATLHTYRGRLSYLPATVEPTSPTPARGLPRAKSELTLAPAPAPAPPVAHSPL
HRSVSDLPLPLPLPQPALTSPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPPLPSP
PSSPKAALLSPITEGVPETLASSGLPPPTPGSPGAVSTRGPHDHLLPPLGTPLPPGWVTL
EGDFVLMLAISPSHLGADLVAAPHARFDDGLVHLCWVRGGISRAALLRLFLAMERGSHFS
LGCPQLGYAAARAFRLEPLTPRGVLTVDGEQVEYGPLQAQMHPGLGTLLTGPPGCPRREP
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgaatggacaccttgaaacagaggagcagggggatcaggccctacacgtacagcggctg
cgcccaaagcctgaagcccggccccggggcggcctcgtcccgctggccgaggtgtccggc
tgctgcaccctgcggagccgcagcccctcggacgcagcggcggcctacttctgcatctac
acctatccgcagggccggcgcgggggccggcgcagagccgcccgcacctttcgggtcgac
ggggcggccacctacgaggagaaccgcgctgaggcccagcgctgggccactgccctcatg
tgtctgctccgtggactgccgctgcctggggacggggaaataacccccgagcttctgcca
aagccaccccgattgctcctattggtcaatccccttggggggcggggcctggcctggcag
tggtgtaagacccacgtgctgcccatgatctccgaagctgggctgtccttcaacctcatc
cagacagaacgacagaaccacgcccgggagctggttcaggggctgaggctgagtgagtgg
gacggcattgtcacggtctccggagacgggctgctgtttgaggtgctgaacggattcctg
gaccgccctgactgggaagaggctgtgaagacgcccgtgggcatcctcccgtgtggctca
ggcaatgccttggccggagctgtgaaccagcatggggggtttgagcctgccctgggtgtg
gacctgctgctcaattgctcgctgctactctgccggggcggcagccgcccgctggacctg
atgtctgtgacgctggcctccggctcccgctgcttgtccttcctgtctgtggcctggggc
ttcgtgtcagacgtggatatccagagcgagcgcttcagggccctgggcagtgcccgcttc
acactgggcacggtgctgggcctcgccacactgcacacctaccgaggacgcctctcctac
ctccctgccaccgtggagcccacctcacccacccctgcccgtggcctgccccgtgccaag
tcagagctgaccctggccccggccccggccccggccccacctgtggcacactcacccctg
catcgttcagtgtctgacctgcccctgcccctgcccctgccccagcccgccctgacctcc
cctggctcgcctgaacccctgcccatcctgtccctcaatggcgggggcccagagttggcc
ggggactggggtggggctggggatgcccccctgtccccagacccaccactgccctcaccg
cctagctcccctaaggcagctttactgtcacccatcaccgagggggtcccagaaacgtta
gcatcctctgggcttccccctcccacccccggctctccgggagccgtctctaccaggggt
ccgcatgaccacctgctccctcctttgggcaccccactccccccaggctgggtgacgctg
gaaggggactttgtgctcatgctggccatctcccctagccacctgggggcagacctggtg
gcagctccccacgcgcgctttgacgacggcctggtgcacctgtgctgggtgcgtggtggc
atctcccgggctgcgctgctacgcctttttctggccatggagcgaggtagccacttcagc
ctgggctgtccgcagctgggctacgccgcggcccgtgccttccgcctcgagcctctcacg
cctcggggcgtgctcactgtggacggagagcaggtggagtacgggccactgcaggcgcag
atgcatccgggcctcggcacgctgctcactgggcctcccggctgcccgcgtcgggagcct
tga

DBGET integrated database retrieval system